KEGG   Bacillus subtilis subsp. subtilis 168: BSU03790Help
Entry
BSU03790          CDS       T00010                                 

Gene name
yclM
Definition
(RefSeq) aspartokinase 3 (EC:2.7.2.4)
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BSU03790 (yclM)
   01230 Biosynthesis of amino acids
    BSU03790 (yclM)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU03790 (yclM)
   00270 Cysteine and methionine metabolism
    BSU03790 (yclM)
   00300 Lysine biosynthesis
    BSU03790 (yclM)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU03790 (yclM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     BSU03790 (yclM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(430623..431987)
Genome map
AA seq 454 aa AA seqDB search
MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAEDTKVTDLLIACAEQYL
ATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVENPKEISE
LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
IASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEHVPSGIDDMTIILRQGQMDAA
TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttaaattcggaggcagctcacttgcttcaggcgcccagcttgacaaggtg
tttcacatcgttacctcagatccggcacggaaagctgtagtcgtttcagctccgggaaaa
cactatgccgaggatacgaaagtgactgatctcttaatcgcatgtgcagaacaatatttg
gcaacaggcagcgcacctgaactggcggaagctgttgtggaacggtacgctctcatcgcc
aatgagcttcagctggggcaaagcattatcgaaaaaatcagagatgatctgtttacgctt
ttagaaggagacaaaagcaatcccgaacaataccttgacgcagtcaaggccagcggagag
gataacaatgccaaactgatcgccgcttacttccgttataaaggcgtcaaagcggaatat
gtaaacccgaaggatgccggcctctttgtgacaaatgaacccggcaacgcgcaagttctt
cctgaatcctatcaaaacctctatcgtcttcgggaacgtgacggactcatcatttttccc
ggttttttcggattcagcaaggatggcgatgtgatcacattctcacggagcggttctgat
attaccggttcgattcttgccaacggactacaagccgatttgtacgaaaactttacagac
gtagacgctgtgtattctgtcaatccgtccttcgttgagaatccaaaggaaatcagcgag
ctgacatatagagagatgcgggagctgtcctacgcgggtttttcagtgtttcatgatgaa
gcgctcattccggcattcagagcggggattcctgttcagatcaaaaatacgaacaacccc
tcagccgaaggcacccgcgtcgtcagcaagcgggataacacaaacgggcctgtcgtcggc
attgccagcgacaccggtttttgcagcatttatatcagcaagtatctcatgaacagagaa
atcggttttggccgcagagcccttcaaatcctggaggagcatggtttgacgtatgagcat
gttccatcgggaatcgatgacatgacaatcattttacggcaggggcaaatggatgccgcc
actgaacgcagcgtcatcaaacggatcgaagaggatttgcatgccgatgaagtcatcgtc
gagcatcatctcgccctgattatggttgtaggggaagcgatgcgccacaatgtcggtaca
acggcaagagccgccaaagcattatcagaggcacaggtgaatatcgaaatgatcaatcag
gggtcttctgaagtgagcatgatgtttggcgtaaaagaagccgaagaaagaaaagccgtt
caagcgttataccaggaatttttcgcgggcgtgctgatctcttaa

DBGET integrated database retrieval system