KEGG   Bacillus subtilis subsp. subtilis 168: BSU03940Help
Entry
BSU03940          CDS       T00010                                 

Gene name
ycnI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1775
Motif
Other DBs
NCBI-GeneID: 938266
NCBI-ProteinID: NP_388276
Pasteur: BG12045
BSORF: BG12045
UniProt: P94431
Position
complement(446174..446788)
Genome map
AA seq 204 aa AA seqDB search
MLKKIALTLCPAIVGSLLFFTAPASAHVSVKPAESAAGSWETYTMKVPSEKNLPTTKVVL
KMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATDGGIQEGQFQQFTFVAKNPDKAEE
AAWDAYQYYKDGSIVEWTGDEDADTPHSITNITSAKQVTDEHGATKTEDDSENSGSSALD
ITAMVLSAAAIILSVAALVKKKRA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaaaaaatcgcattgacactatgtccggctattgtcggctccctcttattcttt
acggcccctgccagcgcgcatgtttctgtaaaaccggctgagtctgctgcaggctcttgg
gaaacgtatacaatgaaggttccttctgagaaaaatctgccgacaacgaaggttgtcctc
aaaatgccgaaggatgttgaattccagcaatatgagccaattccgggctggaaggtttcc
actcaaaaacatgatgacaaatcagtatccgtgacatgggaggcgactgacggaggcatt
caggaaggccagttccagcagtttacctttgttgccaaaaaccctgacaaagcggaggaa
gctgcttgggacgcataccaatattacaaagacggcagcattgttgagtggacaggtgac
gaggatgccgatacacctcattccattacaaacatcacgtctgcaaagcaagtgacagat
gagcacggcgccacgaaaacagaagacgattccgaaaactcaggttcttcagctctagac
attacagcgatggtgctgtctgcggctgccattattttatctgtagcagcacttgtaaag
aaaaagcgtgcctaa

DBGET integrated database retrieval system