KEGG   Bacillus subtilis subsp. subtilis 168: BSU04080Help
Entry
BSU04080          CDS       T00010                                 

Gene name
kipI
Definition
(RefSeq) kinase A inhibitor
  KO
K06351  
inhibitor of KinA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
459867..460589
Genome map
AA seq 240 aa AA seqDB search
MTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPGFIECIPAFTSLTVFY
DMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNRRIVEIPVCYGGEFGPDLEEVA
KINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSPRPSIPAGSVGIA
GLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIVKFVRISEKDYHAYKEESN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacgatatcaaatcgaacagctcggtgattctgcaatgatgatccgattcgga
gaagaaatcaatgaacaggtcaacggcattgtccatgcagcggccgcttatatagaagaa
cagccatttccgggattcattgaatgtatcccggcttttacaagtctaaccgtattttat
gatatgtatgaagtgtacaagcatttgcctcaaggcataagctcaccttttgagagtgtc
aagcgcgatgtcgaagagcggctggcagaaatagccgaagactatgaggtcaaccgccgt
attgtagaaattcccgtttgctatggcggtgaattcggtccggatttagaagaggtggcg
aagatcaatcaactgtcaccggaggaagtaatcgacattcatacaaacggtgaatatgtg
gtgtatatgcttggcttcgcgcccggttttccttttctaggcgggatgtcaaaacgcatt
gcagctccgagaaaatcatcgccaagaccgtcgattcccgcaggttcggtcggtattgcg
ggattgcagacaggcgtttatccgatttcaacgccgggcggctggcagctgatcggcaaa
acgccgctggctcttttccggccgcaggaaaacccgccgacattgctgcgggcgggagat
attgtgaaattcgttcgcatctcagaaaaagactatcacgcctataaggaggagtccaat
tga

DBGET integrated database retrieval system