KEGG   Bacillus subtilis subsp. subtilis 168: BSU04190Help
Entry
BSU04190          CDS       T00010                                 

Gene name
ydaD
Definition
(RefSeq) general stress protein 39
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
471709..472569
Genome map
AA seq 286 aa AA seqDB search
MANYPKELPAQTQSRQPGIESEMNPSPVYEYEDYKGADKLKGKVALITGGDSGIGRAVSV
AYAKEGADIAIVYKDEHEDAEETKKRVEQEGVKCLLIAGDVGEEEFCNEAVEKTVKELGG
LDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKAIDYLKPGSAIINTTSIN
PYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPGPIWTPLIPATFPEETVAQ
FGQDTPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHVNGGNFVTT
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattatccaaaagaactgccggcacaaactcaaagtcgccagccgggaattgaa
agcgaaatgaatccaagtccggtgtatgagtacgaggattataaaggagcagacaaatta
aaaggaaaagtagctcttattacaggcggcgacagcgggatcggacgcgcggtttccgtc
gcttacgcaaaggaaggcgcagacatcgccattgtgtataaggatgagcatgaagacgct
gaggagacgaagaaacgtgttgaacaagaaggcgtaaaatgcctgctgattgctggtgac
gtaggtgaagaggaattctgcaatgaagcggttgaaaaaacggtcaaggaactaggcggc
cttgacatccttgtcaacaatgcaggtgaacagcacccgaaggaaagcatcaaagatatt
acgagcgaacagcttcaccgcacattcaaaacaaatttttattctcaattttatttgact
aaaaaagcaattgattacctgaaaccgggcagcgccatcatcaatacgacatccatcaac
ccgtacgtagggaacccgacactgattgattatacagcgacaaaaggggcgatcaatgcc
tttacaagaacaatggcgcaggcgcttgtcaaagacggcatccgtgtaaatgcagtcgcg
ccgggtccaatttggacgccactaatcccagctacgttccctgaagaaacagttgctcaa
tttgggcaagatacgccgatgggccgtcctggacagcctgttgagcacgtcggctgttat
gtgcttctggcatcagatgagtcctcttacatgacaggtcagaccctgcatgtcaacggc
ggaaactttgtgacgacataa

DBGET integrated database retrieval system