KEGG   Bacillus subtilis subsp. subtilis 168: BSU04580Help
Entry
BSU04580          CDS       T00010                                 

Gene name
cshA
Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K05592  
ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BSU04580 (cshA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BSU04580 (cshA)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU04580 (cshA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA helicases
   BSU04580 (cshA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
511106..512641
Genome map
AA seq 511 aa AA seqDB search
MVNHDITETAIRRSLNNLTITFQDFNLSSDLMKAINRMGFEEATPIQAQTIPLGLSNKDV
IGQAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRAKVL
PIYGGQDIGRQIRALKKNPNIIVGTPGRLLDHINRRTIRLNNVNTVVMDEADEMLNMGFI
DDIESILSNVPSEHQTLLFSATMPAPIKRIAERFMTEPEHVKVKAKEMTVSNIQQFYLEV
QERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLTQAKRMVA
LRKFKEGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGMAMT
FITPREKSMLRAIEQTTKRKMDRMKEPTLDEALEGQQQVTVERLRTTISENNLNFYMTAA
AELLEDHDAVTVVAAAIKMATKEPDDTPVRLTDEAPMVSKRYKNQRSSKRRDGQGGGYRG
GKGKSNNRSSYDKKRSNDRRSSGDRRQKKSY
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaatcacgacattactgaaacagcaattagaaggagtttgaataatttgactata
acgtttcaagattttaatttaagttctgatctcatgaaagcaattaatcgtatgggattt
gaagaagcaacaccgattcaggcacaaacgataccgctcggactttcaaataaagacgtc
attggacaagcgcaaacaggtacaggtaaaacagctgcgtttggtataccccttgttgaa
aaaattaaccccgagtctcctaatattcaagcaatcgtaatcgcgccaacccgtgaatta
gccattcaagtatctgaagaattgtataaaatcggacaagataaacgtgcgaaggttctt
cctatttacggcggacaggatattggacggcaaatccgggcgttaaagaagaatccgaat
attattgtcggaacacctggacgtcttcttgaccacatcaaccgccgcaccattcgttta
aacaatgtaaataccgttgtaatggatgaagcggatgaaatgctgaacatgggattcatt
gacgatattgaatctatcctttcaaacgtgccaagcgagcatcagacacttctgttctct
gccacaatgcctgcgccgatcaaacgcattgcagagcgcttcatgactgagccggaacac
gtaaaagtaaaagcgaaagaaatgacggtttctaacattcagcagttctatttggaagtg
caagaacgtaaaaaattcgatacactgactcgccttcttgatattcagtctcctgagctt
gcgatcgtattcggacgtacaaaacgccgtgtcgatgagctggctgaagctctgaacctt
cgcggatatgcagctgaaggtattcacggtgacttaacgcaggcgaaacgtatggttgcg
cttcgtaaatttaaagaaggcgcaatcgaagttctagtcgcaactgatgttgccgctcgc
ggacttgatatctcaggtgttacacacgtatacaacttcgacgtgcctcaagatcctgaa
agctacgttcaccgtatcggaagaacgggccgtgcaggaaaaacaggtatggcgatgacg
ttcattacaccgcgtgagaaaagcatgcttcgcgcaattgaacaaacaacaaaacgcaaa
atggaccgcatgaaggagcctacacttgatgaagcgttagaaggtcagcaacaggttact
gttgaacgtcttcgcacaacaatcagtgaaaacaacctgaacttctacatgacagcggca
gctgagctgcttgaagatcatgatgcagtaacagtggttgcggcggctatcaaaatggct
acaaaagagccagacgacacaccggttcgcttaacagacgaagcgccgatggtcagcaaa
cgctacaagaaccagcgctcttctaaacgcagagacggtcaaggcggcggctaccgcggc
ggaaaagggaaaagcaacaaccgttcttcctatgacaaaaagcgttcaaacgatcgccgt
tcttcaggtgacagacgccagaaaaaatcttactaa

DBGET integrated database retrieval system