KEGG   Bacillus subtilis subsp. subtilis 168: BSU05840Help
Entry
BSU05840          CDS       T00010                                 

Gene name
gmuD
Definition
6-phospho-beta-glucosidase GmuD (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
628630..630027
Genome map
AA seq 465 aa AA seqDB search
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPF
VNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADV
KAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttggcacatacagaacaatatcgttttccaaaggatttttggtggggatcatccgcttca
gcaacacaaatggagggtgccgccgacagagacggaaaaggccagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcggacccgcagacacatcccaa
ttttacgacaactataaagaagatatcaggctgatgaaggaacttggccacaactcgttc
cggatgtcgatttcctggtcacgtttaataccaaacggaacgggcgagatcaacgataaa
gccgcagatttctataacaatgtcattgatgagctgatcgctaacggaattgaacctttt
gtcaatttgtttcatttcgatatgccgatggcgcttcaaaaaatcggcggctgggtcaac
agagagacggttgacgcgtatgaaaactatgcaagaacttgcttccgtttgtttggcggc
cgggtgaaaaaatggttcacgcataatgaaccaatcgttcccgtagaaggcggataccta
tatgattttcattatccaaacaaggtcgattttaaagaggccgtccaggttggatttcat
acgatgctatcaagtgcccgcgccattcaggcttacagggagatgaagcaggacggaaaa
atcggcatcatcttaaatttgaccccttcatacccgagaagcagccatccggcggatgtg
aaagccggggaaatcgcagacgcgttttttaacagatcttttttagacccatctgtcaaa
ggcgaatttcccaaagagctggttgacattttgaagcatgaaggctttatgcctgattac
aacgctgaagatctcgacatcatcaaaaagaacacggttgacctgttgggagtgaattat
taccagccgagacgtgtgaaagcgaaagaacatcttccgaatcccgacgctccttttttg
ccggacaggtattttgatccctacgtcatgccgggccgcaaaatgaatccgcatcgcggc
tgggagatctatgaaaaaggcgtttatgatattttgatcaatttaaaagaaaactacggc
aacatcgagtgttttatctctgaaaacggtatgggggttgaaggtgaagagcgattcagg
gatgaacaaggcatcattcaggatgattaccggattgaatttataaaagagcacctcaaa
tggattcaccgcgccatacaggaaggctcgaacgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacggatttgtatcagtcaat
cttgagaaagacggagaaagaaccgtcaaaaagagcggaaaatggttcaaagaggttgct
gagcatagcggtttctag

DBGET integrated database retrieval system