KEGG   Bacillus subtilis subsp. subtilis 168: BSU07080Help
Entry
BSU07080          CDS       T00010                                 

Gene name
yesZ
Definition
beta-galactosidase YesZ (EC:3.2.1.-)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSU07080 (yesZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BSU07080 (yesZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BSU07080 (yesZ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BSU07080 (yesZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
774799..776790
Genome map
AA seq 663 aa AA seqDB search
MRKLYHGACYYPELWDEETIQQDIDIMREVGVNVVRIGEFAWSVMEPEEGKIDVGFFKEI
IARLYDSGIETIMCTPTPTPPIWFSHGRPERMHANEKREIMGHGSRQHACTNNPYFRKKA
AIITTAIAKELGRLPGLIGWQLDNEFKCHVAECMCETCLRLWHDWLKNRYGVIERLNEAW
GTDVWSETYQTFEQVPQPGPAPFLHHASLRTMYQLFSMEMIASFADEQAKIIRCYSDAPI
THNGSVMFSVDNERMFQNLDFASYDTYASQENASAFLLNCDLWRNLKQGRPFWILETSPS
YAASLESSAYPHADGYLQAEAVSSYALGSQGFCYWLWRQQRSGSEISHGSVLSAWGEPTI
GYQNVLAVERARKEIEPIILSTEPVQAEAAMTYSDRAKAFIKTEPHRGLRHRSLVTHFYE
RILNTGIHRDLIPEGAPLDGYRLLFTPFVPYLSSEFIKKASAFAEAGGIWITGPLTGGRT
CEHTIHTDCGLGELEKTSGIKTLFTFPMNENVNTGKAFGITAPLGLWSAVFDTESGNTLG
TVEAGPGAGHAFLTERNYGEGKIVMLGSLPSGKEGDAMLEALVRHYAEEAVISSRSDVTP
GTIVAPRIGENGLVWIVVNMDGKGGSVTLPESGTDLLTHRLEKAGRLAVGPHEYRVIQFD
NHS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactgtatcatggcgcttgctattatccggaattatgggatgaagagacgatt
cagcaggacattgacatcatgcgtgaagttggcgtaaatgttgtgcggatcggcgaattt
gcctggtcagtcatggaacctgaagaaggaaaaattgacgtcggttttttcaaagaaatc
atcgcccggctgtatgatagcgggatcgaaacgattatgtgcacgccgacgcctaccccg
ccgatttggttctcacatggccggcccgaacgcatgcatgccaatgaaaaaagagagatc
atggggcatggctcccgtcagcatgcctgtacgaacaacccgtatttccgaaaaaaagcc
gccatcatcaccacagccatcgccaaggagcttggccggctcccggggctgatcggatgg
cagctagacaatgagtttaaatgccatgttgcagaatgcatgtgtgagacatgcttgcgc
ctatggcatgactggctcaaaaatcgctacggggtaattgagcgcttgaatgaagcttgg
ggaaccgatgtgtggagcgagacctatcagacgtttgagcaagtcccgcagccgggaccg
gccccgtttctgcatcatgcctctctacgcactatgtatcagctgttttcgatggagatg
atcgcttcgtttgcggatgaacaggccaaaatcatccgctgctattcagatgcgccgatc
acgcataacggatcagtcatgttcagcgtggacaatgagcgaatgtttcagaatctcgat
tttgcctcctatgacacgtacgcttcgcaggaaaacgcctctgcctttttattgaactgt
gatttatggagaaatctgaaacaagggcgcccgttttggattttggaaacgagtccgtcg
tatgccgcctcgcttgaaagctccgcttacccgcacgcagacgggtatttgcaggccgaa
gccgtatcgtcctacgccttagggagccaggggttttgctactggctatggcgacagcag
cgttcaggcagcgagatttcccacggttcggttctcagtgcctggggcgaacccaccatc
ggctatcaaaatgtgctggcggttgagcgggcaagaaaggaaatcgagcctattattcta
tcgactgaacccgttcaagccgaggcggcgatgacttactctgacagagcaaaagcattt
attaaaactgagcctcaccggggactccggcatcgttcgcttgtgacgcatttttatgaa
cgtattctcaacacggggattcaccgtgaccttattccggaaggcgctccactggacggc
tatcgcttgctgtttacgccatttgtgccgtatttgtcttctgaatttatcaaaaaagct
tcggcattcgctgaagcgggcggcatctggatcaccgggccgctgacaggaggacgcaca
tgcgagcataccattcataccgattgcggacttggcgaacttgagaaaacgtcagggatc
aaaacactttttacctttccgatgaatgagaacgtgaatacaggaaaagcgtttggcatc
acggcgccgctcggactgtggagcgcggtgtttgacacagagagcggaaacacccttggc
acggttgaagcaggaccgggggcgggccatgcttttctgacggaacggaattacggcgag
gggaaaattgtcatgctgggctcgcttccatccgggaaagaaggggatgcgatgctggaa
gcgctcgtcaggcattatgcggaggaagctgttatttccagccggtcggatgtgacaccc
ggcacgatcgttgccccgcgtataggcgaaaacggccttgtgtggatcgttgtgaatatg
gatggaaaaggcgggagcgtgacattgccggaatcgggaacggatttgttgacgcaccgc
ttggaaaaggcggggagactggcggtcggaccgcatgaataccgtgtgattcaatttgac
aatcacagctga

DBGET integrated database retrieval system