KEGG   Bacillus subtilis subsp. subtilis 168: BSU07290Help
Entry
BSU07290          CDS       T00010                                 

Gene name
yfnF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nucleotid_trans Glyco_transf_8
Motif
Other DBs
NCBI-GeneID: 936097
NCBI-ProteinID: NP_388610
Pasteur: BG12977
BSORF: BG12977
UniProt: O06484
Position
800232..801143
Genome map
AA seq 303 aa AA seqDB search
MTSAYCTVLSKGRLYQAVALFKSLEQVDQDSPIFILCMDEDTHRVLQKLKMKQLNLVPVA
ALENELLLKLKETRDQSEYCWTMKPIFLQAVLNSNPELERVTYIDGDLFFYADPSPIFEN
QPDCSVLLSRGDIVIPSFEKEQIDMLQRLLGRYNSGFISFKHDDAGTDCLEWWKERCLEE
CKNAPGEGKFGDQGYLDYMSELFPNVCDITTPGVNIGHWNYGQHTFSWKDGRIVLEDGSP
LIFYHFSGYRIVSINEIKQIHETTRTDLPFVHELYQETLPHIIQHMQTLDPEFNGFASKD
DNK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcgcgtattgcaccgttttatcaaaaggaagattatatcaggcagtcgctttg
tttaagtcgttagagcaagttgatcaagacagtcccatttttatactttgcatggatgaa
gatacgcaccgcgtgttacagaagctgaagatgaagcagctgaaccttgtgccggtggcc
gctcttgaaaatgaattgctgctgaagctgaaggaaactagagatcaaagtgagtattgc
tggacgatgaagccgatctttctgcaagctgtgctgaacagcaatcctgagctggagcgt
gtgacgtatattgacggggatctctttttctatgcagatccatcgccgatttttgaaaac
cagccggactgctcggtgttgctttcacgaggggatattgtaatcccttcttttgagaaa
gagcagattgacatgctgcagcgtcttttaggcagatataattccgggtttatcagcttc
aagcatgatgatgcaggcacggattgcttggagtggtggaaggaacgctgtcttgaggaa
tgcaaaaatgcaccgggtgaagggaaattcggtgatcagggctatttggattatatgtct
gagctgtttccgaatgtgtgtgacattacaacacccggcgtgaacatcggccattggaat
tatggacagcatacgttttcctggaaagatggccggatcgtgctggaggatggcagtccg
ctgatcttttatcatttcagcggataccgaatcgtcagcatcaatgaaatcaaacagatt
catgaaacaacccgcacagatctgccgtttgtgcatgaactgtatcaagagacactgccg
catatcattcagcacatgcaaacgttagaccctgaatttaacggttttgcttcaaaagat
gacaacaaataa

DBGET integrated database retrieval system