KEGG   Bacillus subtilis subsp. subtilis 168: BSU07340Help
Entry
BSU07340          CDS       T00010                                 

Gene name
yfnA
Definition
(RefSeq) amino acid permease YfnA
  KO
K03294  
basic amino acid/polyamine antiporter, APA family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(805456..806841)
Genome map
AA seq 461 aa AA seqDB search
MSSLFRKKPLETLSAQSKSKSLARTLSAFDLTLLGIGCVIGTGIFVITGTVAATGAGPAL
IISFILAGLACALAAFCYAEFSSSIPISGSVYSYSYVTLGELLAFLIGWDLMLEYVIALS
AVATGWSSYFQSLLAGFNLHIPAALTGAPGSMAGAVFNLPAAVIILLITAIVSRGVKEST
RFNNVIVLMKIAIILLFIIVGIGYVKPDNWSPFMPFGMKGVILSAATVFFAYLGFDAVSN
ASEEVKNPQKNMPVGIISALAVCTVLYIAVSLVLTGMMPYAKLNVGDPVSFALKFVGQDA
VAGIISVGAIIGITTVMLALLYAQVRLTFAMSRDGLLPGLFAKVHPSFKTPFRNTWLTGI
VAAGIAGFINLGTLAHLVNMGTLAAFTVISIAVIVLRKKHPEIKASFRVPFVPVVPIISA
GICLWFMYSLPGVTWLSFVIWIAVGTLVYFLYSRKHSLLNK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagttcattatttagaaaaaaaccgcttgaaacattgagtgcgcagagcaagtcaaaa
agccttgcccgtacgttaagcgcatttgatttaaccttgctcggtatcggttgtgtcatc
ggtacagggatttttgtcattacaggaacagtggcagcgaccggtgcaggtcccgccctc
atcatatcgtttattttagcggggctcgcctgtgcgctggctgctttctgttatgctgag
ttttcgtcttccattccgatttcgggaagcgtgtactcatactcatacgtgacacttgga
gagctgctcgcctttttgatcggatgggatctcatgcttgaatatgtcattgcactgtcg
gcggttgccaccggctggtcttcatactttcaatcactgcttgccggcttcaatcttcat
attccggctgcactgacaggagcgccgggaagcatggcgggcgccgtatttaaccttccg
gctgcggtgatcattctcctcatcactgcgattgtcagcagaggcgtcaaggaaagcaca
cgctttaacaacgtcatcgtactgatgaaaatcgcgatcatattattgttcattattgtc
ggcatcggctatgtgaaaccggataactggtctccttttatgccattcgggatgaaaggc
gtcatacttagcgctgccactgtattcttcgcgtaccttgggtttgacgcggtttctaac
gcatcagaggaagtgaaaaatccgcaaaaaaacatgcccgtcggcattatttcagctcta
gccgtctgtacggttctgtacatcgcggtatcgcttgtgctgacaggcatgatgccttat
gccaaattgaatgtcggagatcctgtatcctttgcgctgaaattcgtcggacaggacgct
gttgccggaattatttctgtcggtgcgattatcgggattacgacggtgatgctcgctttg
ctgtacgcacaggtccgcttgacatttgccatgagcagagacggccttctgcctggattg
ttcgcaaaggttcatccgtcatttaaaaccccgttccgcaacacatggctgacagggatc
gttgcagcgggaatcgccggctttattaacctcggaacgctggcccatctggtgaacatg
ggaacacttgccgcgtttacggtcatttccattgctgtcattgtgttaagaaagaaacat
cctgaaatcaaagcgtccttcagagtgccattcgttccggttgtgccgattatcagcgca
ggcatctgcctttggttcatgtacagccttcccggcgtcacatggctttcatttgtcatc
tggatcgctgtcggaacgctggtttacttcctatattcgagaaaacacagcttattaaac
aaataa

DBGET integrated database retrieval system