KEGG   Bacillus subtilis subsp. subtilis 168: BSU07360Help
Entry
BSU07360          CDS       T00010                                 

Gene name
yfmS
Definition
(RefSeq) sensory transducer protein YfmS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
808562..809422
Genome map
AA seq 286 aa AA seqDB search
MELTINTEKETADILDAFIKVAPYLNSLVQDDITIGIYDTEKLLVNIPAKTFSLNVKAGD
PLQEGDIITDAIRSNQKKTSMVPKELFGFPLIARAIPLHDENGRVIGGVGLGTSLEESSK
LHDVAESLSAVVEQTAAAISDISESINGFSTQMSGISSQAKKVSESAGEIADISVTVKGI
SDQSNLLGLNAAIEAARAGESGKGFSVVADEIRKLATHSKENVGQIDQITKKIHSLLKGL
EESIESINQHTDGQAAAVEQISATMQEISGSAQHLAKMAEKALEEE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaccataaatacggaaaaagaaaccgcagatattctggacgcatttatcaaa
gtagccccttatttaaacagcctggttcaggatgatattacaatcggcatttatgatacg
gaaaaactgctcgtgaatataccggccaaaaccttttcgctgaacgtaaaagccggcgat
ccgctgcaggaaggggatatcatcacagatgccatccgcagcaatcagaagaagacgagc
atggttccgaaagaattgttcggcttcccattgatcgcgcgtgccatcccgctgcacgac
gagaatggaagagtcattggaggcgtcggcctcggaacgagccttgaggagtcgtcaaag
ctgcatgatgtcgcggaaagcttatcagctgttgttgaacaaacagccgcggctatttcc
gacatttctgaatcaattaacgggttttcaactcaaatgtcgggcatttcctctcaggcg
aaaaaagtaagcgaaagcgccggtgaaatcgccgatatttcagtaactgttaaaggcatc
tcggaccaaagcaatctgctcggcttgaacgccgcgatcgaagcggcaagagcaggggag
tccggaaaaggattctctgtcgtcgcagatgagatcagaaagctagcgacgcattcaaaa
gaaaatgtcggccaaattgaccagattacgaaaaaaatccacagcctgctgaaagggctg
gaggaatccattgagtcgattaaccagcatacagacggacaagccgctgctgttgaacaa
atttccgccacgatgcaggagatttcaggaagcgcgcagcatcttgcgaaaatggccgaa
aaagcgcttgaggaagagtaa

DBGET integrated database retrieval system