KEGG   Bacillus subtilis subsp. subtilis 168: BSU07400Help
Entry
BSU07400          CDS       T00010                                 

Gene name
yfmO
Definition
(RefSeq) MFS transporter
  KO
K08221  
MFS transporter, ACDE family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Putative aromatic compound/drug exporter (ACDE) family [TC:2.A.1.32]
    BSU07400 (yfmO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
812628..813818
Genome map
AA seq 396 aa AA seqDB search
MDKTTQVNQKTGLLSQPKAVWAVAFACVISFMGIGLVDPILPAIAAQLHASPSEVSLLFT
SYLLVTGFMMFFSGAISSRIGAKWTLILGLIFIIVFAGLGGSSSSIAQLVGYRGGWGLGN
ALFISTALAVIVGVSVGGSAQAIILYEAALGLGISVGPLAGGELGSISWRAPFFGVSVLM
FIALIAISFMLPKLPKPAKRVGVFDAMKALKYKGLLTMAVSAFLYNFGFFILLAYSPFVL
DLDEHGLGYVFFGWGLLLAITSVFTAPLVHKALGTVRSLVVLFIAFAAILVIMGIWTDHQ
TLIITCIVVAGAVLGMVNTIMTTAVMGSAPVERSIASSAYSSVRFIGGALAPWIAGMLSE
HFTASTPYTVGGIVVFVGMLVLLMGRKHLAGIKAGH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggataagacaacacaagtgaatcagaaaacgggtttgctcagccagccaaaagcggta
tgggctgtcgcgtttgcctgtgtgatttcttttatgggaatcgggctggtcgatccaatt
cttccggccattgccgcacaattgcatgcttcacctagtgaagtatcactcttgtttaca
agttatttgcttgtaaccggatttatgatgtttttctcaggagccatttccagccgcatc
ggcgcgaaatggacattaattctcggacttatttttattattgtgtttgcggggcttggc
ggcagctcaagctcaatcgctcagttagtcggctatcgcggcggctggggattagggaat
gctttgtttatttcaacagcgcttgcggtcatcgttggcgtgtcagtcggcggcagcgcc
caagcgattattttgtatgaggccgcgctcggtctcgggatttctgtcgggccgcttgca
ggcggagagctcggaagcatttcatggcgcgcaccgttttttggagtatctgtcctgatg
tttattgcgttaatcgcgatttctttcatgcttccgaagctgccgaaaccggcgaaacgc
gtcggtgtgtttgatgcgatgaaggcactcaaatataaaggcctgctgacaatggcggta
tcggcattcctatacaactttggattttttattttgctagcttattctccgttcgtactg
gatttagatgaacacggtcttggatatgtcttcttcggctggggccttctgctggcgatt
acgtcagtctttacggcgccgctcgtgcacaaagcgctgggcacagtgcgttcgctagtc
gttctctttatcgcctttgcggccattctcgttattatggggatctggacagaccatcag
actttgattattacatgtatcgttgtcgctggtgctgtcctcggtatggtgaatacgatc
atgacaaccgctgtgatgggttctgcgccggttgaacgttcaatcgcgtcttcagcctac
agctcagtccgcttcatcggcggcgcgctcgccccgtggattgcaggaatgctgtcagaa
cactttactgcaagcacaccatatacagtaggcggaatcgtcgtttttgtcggcatgctt
gtccttctcatgggacgtaaacatcttgctggaattaaggcggggcattaa

DBGET integrated database retrieval system