KEGG   Bacillus subtilis subsp. subtilis 168: BSU07790Help
Entry
BSU07790          CDS       T00010                                 

Gene name
yfkQ
Definition
(RefSeq) hypothetical protein
  KO
K06307  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerA
Motif
Other DBs
NCBI-GeneID: 939688
NCBI-ProteinID: NP_388660
Pasteur: BG12932
BSORF: BG12932
UniProt: O34486
Position
complement(848633..850174)
Genome map
AA seq 513 aa AA seqDB search
MNKRDKALQLIKELEDNQDRPISPNLKENLENLTLLTEGCSDIVFRQFDFGNGLCGFIVY
IEGIVKSEHIQDHALRPFLMHLTDQIDEHEEALQNTLSISSVALETSMSKVAASIIEGNA
VLFADGHSKGLILNIKGGQRRSIEEPITESTIRGSREGFTESLRVNTALVRFRVKTFQLK
MISFKIGTKTKTDVVLAYIDGLADPKVIDKAKKRIKKIKIDAVLESGYIEEFIEDDTYSP
FPQLQYTERPDTVAAQLLEGRFAIFTDNTPFVLTGPITFWQLMQASEDYYERYLMSNLIR
WLRYMFLFVALYLPAIYVAVITYHQDLMPTNLMFSVASAREPIPFPAIIEALIMEISFEA
LREAGVRLPKTIGQTVSILGALVIGTAAVEAGIVSAPMVIIVSLTGIASFTIPRFNLAIS
IRMLRFPLMFLASIFGIFGIMLGTIILVLHLCKLQSFGIPYLSGISPFKRDEVKDIFVRA
PWWTMTRRPGTYSRGNGQKGAKREDPKDEENNI
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacgcgacaaagcgcttcagctcatcaaagagcttgaagacaatcaggacaga
ccgatctctcccaatttgaaggaaaacctcgaaaatctgaccttattaacagaaggctgc
tcagacatcgtatttagacaatttgactttggaaacgggctgtgcggatttattgtttat
atcgaaggaattgtaaaatctgaacatattcaggatcacgccctccgccctttcttaatg
catttgacggatcaaatagatgaacatgaagaggcgctgcaaaatactctatcaatttca
agtgttgcattagaaacgagtatgagcaaagtggctgcatccatcattgaggggaacgcg
gttttatttgccgacgggcactcaaaaggcctgatcttaaatataaaaggcggacaaaga
agaagcattgaagagccgataacagaatcgaccatcagagggtcaagagagggcttcact
gaaagcctcagggtcaataccgctcttgtgcgctttcgcgtcaaaacgtttcagcttaaa
atgatctcttttaaaatcggcacgaaaaccaaaaccgatgttgtcttggcctatattgac
gggcttgccgatccaaaggttattgacaaagcaaaaaaaagaatcaaaaagataaagatt
gatgctgtcttagaaagcggatatattgaagaatttatcgaagacgacacgtactcgcca
ttcccccagctgcaatacacagaaaggccggacaccgtcgccgcccagcttctcgaaggc
cgatttgccattttcacagataatacgccctttgtcttaacaggcccgattacgttttgg
cagcttatgcaggccagtgaagattactatgagcgttatttgatgtctaacttaatccgc
tggcttcgctatatgtttttattcgttgctttatatttgccggctatttatgttgccgtt
attacataccaccaggacttaatgccgacaaacttaatgttcagtgtggcctctgcgcgt
gaaccgattcctttccccgccatcatagaagcattgattatggaaatttcttttgaggct
ctccgtgaggcgggagtgcgcctgccgaaaaccatcggccagaccgtcagtattctcggg
gccctagtcattgggacagccgctgttgaagcgggaattgtgtctgcccccatggtgatc
atcgtatcgttaacagggatcgcgtcatttacaattccgcggtttaacttagctatctcc
atcaggatgcttcgtttcccgcttatgtttttggcgagtatttttgggatattcggcatt
atgctcggcacgattatcttagtgcttcatttatgcaagctgcaatctttcggcattcct
tatttatccgggatttctccgtttaaacgagatgaagtaaaagatatttttgtcagggcg
ccttggtggacgatgaccagaaggccgggcacgtattcgcgcggcaacggacagaaggga
gcgaaaagagaggacccaaaagatgaagaaaacaatatataa

DBGET integrated database retrieval system