KEGG   Bacillus subtilis subsp. subtilis 168: BSU09270Help
Entry
BSU09270          CDS       T00010                                 

Gene name
glpP
Definition
(RefSeq) glycerol uptake operon antiterminator regulatory protein
  KO
K02443  
glycerol uptake operon antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU09270 (glpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1001744..1002322
Genome map
AA seq 192 aa AA seqDB search
MMSFHNQPILPAIRNMKQFDEFLNSSFSYGVILDIHLGQLKGVIKEAQKHGKNMMVHVDL
IQGIKHDEYGAEFICQDIKPAGIISTRSNVIAKAKQKKIYAIQRLFLLDTSAMEKSMEFI
GKHKPDFIEVLPGIVPSLIQEIKEKTGIPIFAGGFIRTEEDVEQALKAGAVAVTTSNTKL
WKKYENFLTESD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatgagttttcacaaccagccgatcttaccggctattcgcaatatgaagcaatttgat
gagtttttgaacagttcattctcttacggtgttattcttgatattcatctcggccagctg
aagggcgtgatcaaagaagcgcaaaagcacggaaagaacatgatggtgcacgtcgatctc
attcaagggattaagcatgacgaatacggtgcggaatttatatgtcaggatatcaagccc
gctgggattatttccacaagatcgaatgtgattgccaaagcgaagcagaagaaaatttat
gccattcagcgcctgtttttgcttgatacaagcgcgatggagaaaagcatggagtttatc
ggcaagcataagcctgacttcatcgaagtgcttcccggcatcgttccgtcactcattcag
gaaataaaagagaaaacagggattcccatctttgccgggggtttcatccgtacggaagag
gatgtagagcaggcattgaaagcgggggctgtagctgtcacaacatctaataccaaattg
tggaaaaaatatgaaaactttttgacggaaagtgattga

DBGET integrated database retrieval system