KEGG   Bacillus subtilis subsp. subtilis 168: BSU10040Help
Entry
BSU10040          CDS       T00010                                 

Gene name
ecsA
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  
ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
ABC-2 type transport system
Brite
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    BSU10040 (ecsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1077440..1078183
Genome map
AA seq 247 aa AA seqDB search
MSLLSVKDLTGGYTRNPVLKNVSFTLEPNQIVGLIGLNGAGKSTTIRHIIGLMDPHKGSI
ELNGKTFAEDPEGYRSQFTYIPETPVLYEELTLMEHLELTAMAYGLSKETMEKRLPPLLK
EFRMEKRLKWFPAHFSKGMKQKVMIMCAFLAEPALYIIDEPFLGLDPLAINALLERMNEA
KKGGASVLMSTHILATAERYCDSFIILHNGEVRARGTLSELREQFGMKDAALDDLYLELT
KEDAGHE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctatcggtaaaagacttgaccggcggatatacaaggaatccggttttaaaa
aacgtatcattcacccttgaaccgaatcaaattgtcggcttaatcgggctgaatggtgct
ggtaaaagtacaacaatcagacacatcatcgggctgatggacccgcataaaggttcaatc
gaattaaacggtaaaacgtttgctgaggatccggaaggctaccgttcacaatttacctat
atacctgaaacacctgttttatacgaagaattgacgctgatggagcatcttgaactaaca
gccatggcatatggactgtcaaaagaaacgatggagaaaaggctgcctccgctactaaag
gaattccgaatggaaaagaggctgaagtggttcccggcccatttttctaaaggaatgaag
cagaaggttatgattatgtgcgcatttttggcagagcctgcgctctacattattgatgag
ccttttctagggcttgatccgcttgccattaacgcgctgcttgaacggatgaatgaagcg
aaaaaaggcggggcgagcgtgctgatgtcaacacacattttggcaacggcagaacgctat
tgcgattcgtttattattttacataacggcgaggtgcgggcgcgcggcacgctgtcagag
ctcagagagcagtttggaatgaaggacgcggcgctggacgatttgtatcttgagcttaca
aaggaagacgctggccatgaataa

DBGET integrated database retrieval system