KEGG   Bacillus subtilis subsp. subtilis 168: BSU10140Help
Entry
BSU10140          CDS       T00010                                 

Gene name
hemY
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU10140 (hemY)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BSU10140 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BSU10140 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 MCRA HI0933_like Pyr_redox Trp_halogenase SEA Thi4 FAD_binding_2 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 936311
NCBI-ProteinID: NP_388895
Pasteur: BG10431
BSORF: BG10431
UniProt: P32397
Structure
PDB: 

Jmol
Position
1088197..1089609
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgagctgacacttgtt
gaggcaagtccgagagtcggcgggaaaatccagactgtcaagaaagacggctatatcatc
gaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgttaaagac
ttaggtcttgagcatttgcttgtcaacaatgcgaccgggcaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggcgctgtaatggggataccgacaaaaattgcgccg
tttgtttctacgggtctgttttccttgtccgggaaggcgagagctgctatggatttcatc
ctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattcttccgcagacgtgtc
ggagatgaagtggtcgagaacttaatcgagccgctactatcagggatctacgcaggcgac
attgacaagctcagcctgatgtcgacatttccgcaattttatcagacggaacaaaagcat
agaagcctgattctcggcatgaaaaaaacaaggcctcaaggctcaggccagcagctgacg
gcaaaaaaacaagggcagttccaaactctgtcaaccggtttgcagacccttgtagaagag
atcgaaaagcagttaaagctgacgaaggtgtataaaggcacaaaagtgaccaaacttagc
catagcggctcttgctattcgctcgaactggataacggcgtcacacttgatgctgattca
gtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcctgccatt
tctcatttgaaaaatatgcactccacatccgtggcaaacgtcgctttaggtttccctgaa
ggctccgtccaaatggagcatgagggcacgggttttgtcatttcaagaaacagtgacttt
gcgatcacagcctgtacgtggacgaataaaaaatggccgcacgcagcgccggaaggcaaa
acgctgcttcgggcatatgtcggaaaagccggagacgaatccattgtcgatctatcagat
aatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaacggcgag
ccggaaatgacatgtgtaacccgatggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgtatcaaggagctgcgtgaagcacttgcatctgcgtatccgggtgtttatatg
acaggcgcttctttcgaaggtgtcggcattcccgactgcattgatcaaggaaaagctgcc
gtgtctgacgcgcttacctatttattcagctaa

DBGET integrated database retrieval system