KEGG   Bacillus subtilis subsp. subtilis 168: BSU10300Help
Entry
BSU10300          CDS       T00010                                 

Gene name
aprE
Definition
subtilisin E (EC:3.4.21.62)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BSU10300 (aprE)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S8: subtilisin family
   BSU10300 (aprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1104423..1105568)
Genome map
AA seq 381 aa AA seqDB search
MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPTGSTA
LKTVVDKAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGS
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGNSFYYGKGLINVQAAAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagcaaaaaattgtggatcagcttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaaatacatt
gtcggatttaaacagacaatgagtgccatgagttccgccaagaaaaaggatgttatttct
gaaaaaggcggaaaggttcaaaagcaatttaagtatgttaacgcggccgcagcaacattg
gatgaaaaagctgtaaaagaattgaaaaaagatccgagcgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttatggcatttctcaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaacgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagttctcacggtacgcatgtagccggtacgattgccgct
cttaataactcaatcggtgttctgggcgtagcgccaagcgcatcattatatgcagtaaaa
gtgcttgattcaacaggaagcggccaatatagctggattattaacggcattgagtgggcc
atttccaacaatatggatgttatcaacatgagccttggcggacctactggttctacagcg
ctgaaaacagtcgttgacaaagccgtttccagcggtatcgtcgttgctgccgcagccgga
aacgaaggttcatccggaagcacaagcacagtcggctaccctgcaaaatatccttctact
attgcagtaggtgcggtaaacagcagcaaccaaagagcttcattctccagcgcaggttct
gagcttgatgtgatggctcctggcgtgtccatccaaagcacacttcctggaggcacttac
ggcgcttataacggaacgtccatggcgactcctcacgttgccggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagtccgtgatcgtttagaaagcactgca
acatatcttggaaactctttctactatggaaaagggttaatcaacgtacaagcagctgca
caataa

DBGET integrated database retrieval system