KEGG   Bacillus subtilis subsp. subtilis 168: BSU10350Help
Entry
BSU10350          CDS       T00010                                 

Gene name
yhfS
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU10350 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU10350 (yhfS)
   00640 Propanoate metabolism
    BSU10350 (yhfS)
   00650 Butanoate metabolism
    BSU10350 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    BSU10350 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BSU10350 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU10350 (yhfS)
   00310 Lysine degradation
    BSU10350 (yhfS)
   00380 Tryptophan metabolism
    BSU10350 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU10350 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU10350 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU10350 (yhfS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSU10350 (yhfS)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU10350 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(1109388..1110482)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDEGFYREEVVALGE
LETDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNFPPAAPVVAIRQLLHTHDVTPDDIDLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRPDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctactggcagaggcggcaacctggcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gctcgcttttctccagatgcgatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatgaaggattttaccgtgaagaagttgttgctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagtggcatagca
gacggagcagccgctcttttggtaatggaagaagaaaaagcagcagccctgggacttaag
cctgtgcttcggtttatcggcagcgctgtcagcggcattcaccccaactttccgcccgcg
gcaccggttgtcgcgattcgtcagctcttacatacacacgatgtaacacctgatgatatc
gatttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgccttagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggccagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system