KEGG   Bacillus subtilis subsp. subtilis 168: BSU11430Help
Entry
BSU11430          CDS       T00010                                 

Gene name
oppA
Definition
(RefSeq) oligopeptide ABC transporter binding lipoprotein
  KO
K15580  
oligopeptide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
beta-Lactam resistance
ABC transporters
Quorum sensing
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU11430 (oppA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11430 (oppA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BSU11430 (oppA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    BSU11430 (oppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1219849..1221486
Genome map
AA seq 545 aa AA seqDB search
MKKRWSIVTLMLIFTLVLSACGFGGSGSNGEGKKDSKGKTTLNINIKTEPFSLHPGLAND
SVSGGVIRQTFEGLTRINADGEPEEGMASKIETSKDGKTYTFTIRDGVKWSNGDPVTAQD
FEYAWKWALDPNNESQYAYQLYYIKGAEAANTGKGSLDDVAVKAVNDKTLKVELNNPTPY
FTELTAFYTYMPINKKIAEKNKKWNTNAGDDYVSNGPFKMTAWKHSGSITLEKNDQYWDK
DKVKLKKIDMVMINNNNTELKKFQAGELDWAGMPLGQLPTESLPTLKKDGSLHVEPIAGV
YWYKFNTEAKPLDNVNIRKALTYSLDRQSIVKNVTQGEQIPAMAAVPPTMKGFEDNKEGY
FKDNDVKTAKEYLEKGLKEMGLSKASDLPKIKLSYNTDDAHAKIAQAVQEMWKKNLGVDV
ELDNSEWNVYIDKLHSQDYQIGRMGWLGDFNDPINFLELFRDKNGGNNDTGWENPEFKKL
LNQSQTETDKTKRAELLKKAEGIFIDEMPVAPIYFYTDTWVQDENLKGVIMPGTGEVYFR
NAYFK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgttggtcgattgtcacgttgatgctcattttcactctcgtgctgagcgcg
tgcggctttggcggcagcggatcaaacggtgaagggaaaaaggacagtaaaggaaagacg
acacttaacattaatattaaaactgagccgttctccttacatccgggattggcaaatgat
tcagtatcaggcggtgttatccgtcagacttttgaaggattgacacgtatcaatgcagat
ggtgagcctgaagaaggcatggcttctaaaattgaaacgagcaaggacggaaagacatat
acatttaccattcgtgatggtgtgaaatggtctaatggagaccctgtaactgcacaagat
tttgaatatgcttggaaatgggcgcttgaccctaataatgaatcacaatacgcttaccag
ctctactacataaaaggtgctgaagcggcgaataccggaaaaggcagcctagacgatgtg
gcagtaaaagctgtgaatgacaaaacgctgaaggttgaattaaataacccgactccatat
ttcactgaattaactgcgttctatacgtatatgccgatcaataagaaaattgcagagaaa
aataaaaagtggaatacaaatgccggagatgattatgtatcaaacgggccgttcaaaatg
acggcatggaaacacagcggctctattactctcgaaaaaaatgaccagtattgggataaa
gacaaagtcaaactgaagaaaatcgatatggttatgatcaacaataacaatacggaacta
aaaaaattccaagctggcgaacttgattgggccggtatgccgctcggacagcttccgaca
gaatccctgccgaccctgaaaaaagacggttctttacatgttgagccgattgcaggagtg
tattggtacaaattcaacactgaagctaagccattagacaacgtcaatatccgtaaagct
ttaacatattcgcttgaccgtcagtcgattgttaaaaacgttacgcaaggagagcaaatc
ccggcaatggctgcagtgccgcctacaatgaagggatttgaggataacaaagaaggatac
ttcaaagacaatgatgtcaaaacagcaaaagaataccttgaaaaaggcctaaaagaaatg
ggcttaagcaaggcatctgatttgccaaaaatcaaattgtcttacaacactgatgacgca
cacgcgaaaatcgctcaagcagtacaagaaatgtggaagaaaaatttaggcgttgatgtt
gagcttgataactcagagtggaatgtctatattgataagctccacagccaagattatcaa
atcggccgtatgggctggctcggcgacttcaatgatcctatcaacttccttgaattgttc
cgcgacaaaaacggaggaaataacgatacaggctgggaaaatccagaattcaaaaagctt
ctgaatcagtcacaaactgaaacagataaaacaaaacgtgcagagctgctgaaaaaagca
gaaggtattttcattgatgaaatgccggttgccccaatctatttctatactgatacttgg
gtacaggatgaaaacctaaaaggtgttatcatgccaggtactggtgaggtttatttcaga
aacgcatattttaaataa

DBGET integrated database retrieval system