KEGG   Bacillus subtilis subsp. subtilis 168: BSU12620Help
Entry
BSU12620          CDS       T00010                                 

Gene name
xkdH
Definition
(RefSeq) phage-like element PBSX protein XkdH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
1330892..1331248
Genome map
AA seq 118 aa AA seqDB search
MSYRQMLIHRCDIYHEAAQAPSAGRFGIPADRLQPVISYPDTPDEQDVPCYFTEKTQQLI
QEEPDQTVYHSFLVHFPLSADIRVNDKIIWENHKYILKLPKRIRHHHWEVVAVRDESL
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaggcagatgctcattcaccgctgcgatatttatcatgaagcagcgcaagcg
ccgtctgcaggccgatttgggattccggcagacaggctgcagccggtgatttcatatccg
gatacacccgatgaacaagatgtcccttgttattttaccgaaaaaacacagcagctgatt
caggaggagccggatcaaactgtatatcatagctttctcgtccattttccgttgtcagcg
gacatccgcgtgaacgataaaatcatttgggagaatcataaatatatactaaagctgccg
aaaaggatcagacatcatcattgggaggtcgtcgcagtcagggatgaaagcctatga

DBGET integrated database retrieval system