KEGG   Bacillus subtilis subsp. subtilis 168: BSU13620Help
Entry
BSU13620          CDS       T00010                                 

Gene name
mtnD
Definition
acireductone dioxygenase (EC:1.13.11.53 1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bsu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1429584..1430120
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEANTTIENQEEVASFLDSQEVIYEQWDITRLPEHLSEKYDLTEEEKQQILDT
FETEIKDISTRRGYKAQDVISLSDSNPKLDELLENFKREHHHTDDEVRFIVSGHGIFVIQ
GQDGTFFDVRLNPGDLISVPENIRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKDSVNQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattcgaattcatgatgaggcaaatacaacgattgaaaatcaagaggaagtg
gcaagctttctggacagtcaagaggttatttatgagcaatgggatatcacgaggcttccg
gaacatctctcagagaaatatgacctgacagaagaagaaaaacagcaaattcttgatacc
ttcgaaactgaaattaaagatatctcaacccgccgcggctataaagcacaggatgttatt
tcattgtcagacagcaatccgaaacttgatgaactgcttgaaaactttaaaagagagcat
caccatacagacgatgaggttcgttttattgtaagcggacacggtatttttgtcattcaa
ggccaggacggcacgttttttgatgtccgtttaaaccctggagatttaatctccgtgcct
gagaatatccgccattacttcacgcttcaggaggaccgcaaagttgtcgcggtgagaatt
tttgtcacaactgaaggctgggttcctatttatgaaaaagacagcgtgaatcaataa

DBGET integrated database retrieval system