KEGG   Bacillus subtilis subsp. subtilis 168: BSU13620Help
Entry
BSU13620          CDS       T00010                                 

Gene name
mtnD
Definition
(RefSeq) acireductone dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13620 (mtnD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BSU13620 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BSU13620 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding SH3BGR Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 939322
NCBI-ProteinID: NP_389245
Pasteur: BG13285
BSORF: BG13285
UniProt: O31669
Position
1429584..1430120
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEANTTIENQEEVASFLDSQEVIYEQWDITRLPEHLSEKYDLTEEEKQQILDT
FETEIKDISTRRGYKAQDVISLSDSNPKLDELLENFKREHHHTDDEVRFIVSGHGIFVIQ
GQDGTFFDVRLNPGDLISVPENIRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKDSVNQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattcgaattcatgatgaggcaaatacaacgattgaaaatcaagaggaagtg
gcaagctttctggacagtcaagaggttatttatgagcaatgggatatcacgaggcttccg
gaacatctctcagagaaatatgacctgacagaagaagaaaaacagcaaattcttgatacc
ttcgaaactgaaattaaagatatctcaacccgccgcggctataaagcacaggatgttatt
tcattgtcagacagcaatccgaaacttgatgaactgcttgaaaactttaaaagagagcat
caccatacagacgatgaggttcgttttattgtaagcggacacggtatttttgtcattcaa
ggccaggacggcacgttttttgatgtccgtttaaaccctggagatttaatctccgtgcct
gagaatatccgccattacttcacgcttcaggaggaccgcaaagttgtcgcggtgagaatt
tttgtcacaactgaaggctgggttcctatttatgaaaaagacagcgtgaatcaataa

DBGET integrated database retrieval system