KEGG   Bacillus subtilis subsp. subtilis 168: BSU13690Help
Entry
BSU13690          CDS       T00010                                 

Gene name
motA
Definition
(RefSeq) motility protein A
  KO
K02556  
chemotaxis protein MotA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Two-component system
Bacterial chemotaxis
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU13690 (motA)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BSU13690 (motA)
   02040 Flagellar assembly
    BSU13690 (motA)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU13690 (motA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    BSU13690 (motA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(1434433..1435245)
Genome map
AA seq 270 aa AA seqDB search
MDKTSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVP
TLFRVLFKENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVDDAFLKNGLSMAVDGQ
SAEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSHMDNTDELG
HAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVMIEGVLSVLEGQAPKVIEQ
KLLMYLPAKDRLKFAEQGEAQNGEKKEEEA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacttcgttaatcggtattattcttgcttttgtggcattgagcgtcgggatg
gttctgaaaggcgtcagtttcagcgcccttgcaaaccccgctgccattttaattattatc
gccgggacaatctcagcagtcgttattgcgttcccaacaaaagaaattaaaaaagtgcct
acgctgtttcgagtgttatttaaggaaaataaacagctcacaatagaggaactcattcct
atgttctctgaatgggctcagcttgcacgccgcgaaggtctgcttgctttagaagcaagc
attgaggatgtagatgatgctttcttgaaaaacgggctcagcatggctgttgacgggcaa
agcgcggaatttataagagatattatgacagaggaagtcgaagcaatggaggacaggcac
caagcaggagccgctatttttacacaagcaggaacgtacgctccgacacttggagtactc
ggcgctgtaatcgggctgattgccgctctctctcatatggataacacagatgagcttgga
cacgccatcagtgctgcctttgttgccacacttctcggtatctttacagggtatgtgtta
tggcatcctttcgcaaataaattaaaacgaaaatcaaaacaggaagtaaaactgcgtgag
gtcatgattgaaggtgttttatccgttttagaaggacaagcaccgaaagtcatcgaacaa
aagcttttaatgtatcttcctgcgaaggaccgcttgaaatttgcagaacaaggagaggcg
caaaatggcgagaaaaaagaagaagaagcatga

DBGET integrated database retrieval system