KEGG   Bacillus subtilis subsp. subtilis 168: BSU13890Help
Entry
BSU13890          CDS       T00010                                 

Gene name
ptsG
Definition
(RefSeq) PTS system glucose-specific EIICBA component
  KO
K20116  
PTS system, glucose-specific IIA component [EC:2.7.1.199]
K20117  
PTS system, glucose-specific IIB component [EC:2.7.1.199]
K20118  
PTS system, glucose-specific IIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Phosphotransferase system (PTS)
Module
PTS system, glucose-specific II component
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU13890 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU13890 (ptsG)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU13890 (ptsG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     BSU13890 (ptsG)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component [MD:M00809]
    BSU13890 (ptsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
1457187..1459286
Genome map
AA seq 699 aa AA seqDB search
MFKALFGVLQKIGRALMLPVAILPAAGILLAIGNAMQNKDMIQVLHFLSNDNVQLVAGVM
ESAGQIVFDNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVSMSAVLLANGTIPSDSV
ERAKFFTENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYTIELPQYLGFFAGKRF
VPIVTSISALILGLIMLVIWPPIQHGLNAFSTGLVEANPTLAAFIFGVIERSLIPFGLHH
IFYSPFWYEFFSYKSAAGEIIRGDQRIFMAQIKDGVQLTAGTFMTGKYPFMMFGLPAAAL
AIYHEAKPQNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLFAIHCLFAGLSFMVM
QLLNVKIGMTFSGGLIDYFLFGILPNRTAWWLVIPVGLGLAVIYYFGFRFAIRKFNLKTP
GREDAAEETAAPGKTGEAGDLPYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKDRL
KQLGASGVLEVGNNIQAIFGPRSDGLKTQMQDIIAGRKPRPEPKTSAQEEVGQQVEEVIA
EPLQNEIGEEVFVSPITGEIHPITDVPDQVFSGKMMGDGFAILPSEGIVVSPVRGKILNV
FPTKHAIGLQSDGGREILIHFGIDTVSLKGEGFTSFVSEGDRVEPGQKLLEVDLDAVKPN
VPSLMTPIVFTNLAEGETVSIKASGSVNREQEDIVKIEK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcattattcggcgttcttcaaaaaattgggcgtgcgcttatgcttccagtt
gcgatccttccggctgcgggtattttgcttgcgatcgggaatgcgatgcaaaataaggac
atgattcaggtcctgcatttcttgagcaatgacaatgttcagcttgtagcaggtgtgatg
gaaagtgctgggcagattgttttcgataaccttccgcttcttttcgcagtaggtgtagcc
atcgggcttgccaatggtgatggagttgcagggattgcagcaattatcggttatcttgta
atgaatgtatccatgagtgcggttcttcttgcaaacggaaccattccttcggattcagtt
gaaagagccaagttctttacggaaaaccatcctgcatatgtaaacatgcttggtatacct
accttggcgacaggggtgttcggcggtattatcgtcggtgtgttagctgcattattgttt
aacagattttacacaattgaactgccgcaataccttggtttctttgcgggtaaacgtttc
gttccaattgttacgtcaatttctgcactgattctgggtcttattatgttagtgatctgg
cctccaatccagcatggattgaatgccttttcaacaggattagtggaagcgaatccaacc
cttgctgcatttatcttcggggtgattgaacgttcgcttatcccattcggattgcaccat
attttctattcaccgttctggtatgaattcttcagctataagagtgcagcaggagaaatc
atccgcggggatcagcgtatctttatggcgcagattaaagacggcgtacagttaacggca
ggtacgttcatgacaggtaaatatccatttatgatgttcggtctgcctgctgcggcgctt
gccatttatcatgaagcaaaaccgcaaaacaaaaaactcgttgcaggtattatgggttca
gcggccttgacatctttcttaacggggatcacagagccattggaattttctttcttattc
gttgctccagtcctgtttgcgattcactgtttgtttgcgggactttcattcatggtcatg
cagctgttgaatgttaagattggtatgacattctccggcggtttaattgactacttccta
ttcggtattttaccaaaccggacggcatggtggcttgtcatccctgtcggcttagggtta
gcggtcatttactactttggattccgatttgccatccgcaaatttaatctgaaaacacct
ggacgcgaggatgctgcggaagaaacagcagcacctgggaaaacaggtgaagcaggagat
cttccttatgagattctgcaggcaatgggtgaccaggaaaacatcaaacaccttgatgct
tgtatcactcgtctgcgtgtgactgtaaacgatcagaaaaaggttgataaagaccgtctg
aaacagcttggcgcttccggagtgctggaagtcggcaacaacattcaggctattttcgga
ccgcgttctgacgggttaaaaacacaaatgcaagacattattgcgggacgcaagcctaga
cctgagccgaaaacatctgctcaagaggaagtaggccagcaggttgaggaagtgattgca
gaaccgctgcaaaatgaaatcggcgaggaagttttcgtttctccgattaccggggaaatt
cacccaattacggatgttcctgaccaagtcttctcagggaaaatgatgggtgacggtttt
gcgattctcccttctgaaggaattgtcgtatcaccggttcgcggaaaaattctcaatgtg
ttcccgacaaaacatgcgatcggcctgcaatccgacggcggaagagaaattttaatccac
tttggtattgataccgtcagcctgaagggcgaaggatttacgtctttcgtatcagaagga
gaccgcgttgagcctggacaaaaacttcttgaagttgatctggatgcagtcaaaccgaat
gtaccatctctcatgacaccgattgtatttacaaaccttgctgaaggagaaacagtcagc
attaaagcaagcggttcagtcaacagagaacaagaagatattgtgaagattgaaaaataa

DBGET integrated database retrieval system