KEGG   Bacillus subtilis subsp. subtilis 168: BSU13990Help
Entry
BSU13990          CDS       T00010                                 

Gene name
kinA
Definition
(RefSeq) sporulation kinase A (EC:2.7.3.-)
  KO
K02491  
two-component system, sporulation sensor kinase A [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Two-component system
Module
KinABCDE-Spo0FA (sporulation control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU13990 (kinA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU13990 (kinA)
Protein kinases [BR:bsu01001]
 Histidine protein kinases
  Spo family [OT]
   BSU13990 (kinA)
Two-component system [BR:bsu02022]
 Spo family
  KinABCDE-Spo0FA [MD:M00485]
   BSU13990 (kinA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
1470026..1471846
Genome map
AA seq 606 aa AA seqDB search
MEQDTQHVKPLQTKTDIHAVLASNGRIIYISANSKLHLGYLQGEMIGSFLKTFLHEEDQF
LVESYFYNEHHLMPCTFRFIKKDHTIVWVEAAVEIVTTRAERTEREIILKMKVLEEETGH
QSLNCEKHEIEPASPESTTYITDDYERLVENLPSPLCISVKGKIVYVNSAMLSMLGAKSK
DAIIGKSSYEFIEEEYHDIVKNRIIRMQKGMEVGMIEQTWKRLDGTPVHLEVKASPTVYK
NQQAELLLLIDISSRKKFQTILQKSRERYQLLIQNSIDTIAVIHNGKWVFMNESGISLFE
AATYEDLIGKNIYDQLHPCDHEDVKERIQNIAEQKTESEIVKQSWFTFQNRVIYTEMVCI
PTTFFGEAAVQVILRDISERKQTEELMLKSEKLSIAGQLAAGIAHEIRNPLTAIKGFLQL
MKPTMEGNEHYFDIVFSELSRIELILSELLMLAKPQQNAVKEYLNLKKLIGEVSALLETQ
ANLNGIFIRTSYEKDSIYINGDQNQLKQVFINLIKNAVESMPDGGTVDIIITEDEHSVHV
TVKDEGEGIPEKVLNRIGEPFLTTKEKGTGLGLMVTFNIIENHQGVIHVDSHPEKGTAFK
ISFPKK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaggatacgcagcatgttaaaccacttcaaacaaaaaccgatattcatgcagtc
ttggcctctaatggacgcatcatttatatatctgccaactccaaactgcatttgggctat
ctccaaggagagatgatcggatcattcctcaaaacgtttctgcatgaggaagaccaattt
ttggttgaaagctatttttataatgaacatcatctgatgccgtgcacctttcgttttatt
aaaaaagatcatacgattgtgtgggtggaggctgcggtagaaattgttacgacaagagct
gagcggacagaacgggaaatcattttgaaaatgaaggttcttgaagaagaaacaggccat
caatccctaaactgcgaaaaacatgaaatcgaacctgcaagcccggaatcgactacatat
ataacggatgattatgaacggttggttgaaaatctcccgagtccgctatgcatcagtgtc
aaaggcaagatcgtctatgtaaacagcgcgatgctttcaatgctgggagccaaaagcaag
gatgctattattggtaaatcgtcctatgaatttattgaagaagaatatcatgatatcgtg
aaaaacaggattatacgaatgcaaaaaggaatggaagtcggaatgattgaacagacgtgg
aaaaggcttgatggcacacctgttcatttagaagtgaaagcatccccgaccgtctacaaa
aaccagcaggctgagctgctgctgctgatcgatatctcttcaaggaaaaaattccaaacc
atcctgcaaaaaagccgtgaacgatatcagctgctgattcaaaattccattgataccatt
gcggtgattcacaatggaaaatgggtatttatgaatgaatcgggaatttccctgtttgaa
gcggctacatatgaggatttaattggcaaaaacatatacgatcagctgcatccttgcgat
cacgaggatgtaaaagagagaatccaaaacattgccgagcaaaaaacagaatctgaaatt
gtcaagcaatcctggttcacctttcagaacagggtcatctatacggagatggtctgcatt
ccgacgaccttttttggtgaagcggccgtccaggtcattcttcgggacatctcagagaga
aaacaaacagaagaattgatgctgaaatcggaaaaattatcaatcgcagggcagctcgcg
gcgggaatcgcccatgagatccgcaaccctcttacagcgatcaaaggatttttacagctg
atgaaaccgacaatggaaggcaacgaacattactttgatattgtgttttctgaactcagc
cgtatcgaattaatactcagtgaactgctcatgctggcgaaacctcagcaaaatgctgtc
aaagaatatttgaacttgaaaaaattaattggtgaggtttcagccctgttagaaacgcag
gcgaatttaaatggcatttttatcagaacaagttatgaaaaagacagcatttatataaac
ggggatcaaaaccaattaaagcaggtattcattaatttaatcaaaaatgcagttgaatca
atgcctgatgggggaacagtagacattatcataaccgaagatgagcattctgttcatgtt
actgtcaaagacgaaggggaaggtatacctgaaaaggtactaaaccggattggagagcca
tttttaacaacaaaagaaaaaggtacggggcttggattaatggtgacatttaatatcatt
gaaaaccatcagggagttatacatgtggacagccatcctgaaaaaggcacagcgtttaaa
atttcatttccaaaaaaataa

DBGET integrated database retrieval system