KEGG   Bacillus subtilis subsp. subtilis 168: BSU14830Help
Entry
BSU14830          CDS       T00010                                 

Gene name
ylaM
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU14830 (ylaM)
   00330 Arginine and proline metabolism
    BSU14830 (ylaM)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU14830 (ylaM)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BSU14830 (ylaM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1551385..1552314
Genome map
AA seq 309 aa AA seqDB search
MVCQHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKT
FTLQSISKVLSLALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGA
LVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYG
IFEDDVEAVMDLYTKQCAIEMNSLDLAKIGSVFALNGRHPETGEQVISKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIM
SEMYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccagcataatgatgagcttgaagccttagtgaaaaaggcgaaaaaagtaacg
gacaagggggaggtagccagctatattcccgccttggcaaaagctgataaacacgacctg
tcagtggcgatttattattccaataatgtttgtctgtcagcaggtgacgtagaaaaaaca
tttacgcttcaaagtatatcgaaagtcctttcccttgctttggtgttaatggaatacggc
aaagataaggtcttcagttatgttggacaggagccgaccggtgatccgtttaattcaatt
atcaagctcgaaacagtgaatccgagcaagccgttaaaccctatgattaatgccggggca
ttggtagtgacaagtctgataaggggaagaacggtaaaagagagacttgattatttgctt
tcttttatcagaaggctgacaaacaaccaagagattacatactgccgggaagtggctgaa
tctgaatacagcacttcaatgattaatcgggcgatgtgttattatatgaagcagtacggc
atttttgaagatgatgtagaggcagtaatggatttatatacgaagcaatgcgcgattgag
atgaacagcttggatttagcgaaaatcggatctgtattcgcattgaacggcagacatcca
gagactggggagcaggtcatctcaaaagatgtcgctagaatttgcaaaacgtttatggtg
acgtgcggaatgtacaatgcaagcggggaattcgcaattaaggtcggaattcctgcgaaa
agcggcgtatccggcgggataatgggcatttcgccttacgatttcgggatcggcatattc
ggccccgcattagacgaaaaagggaacagcattgcaggtgtaaagcttttggaaataatg
tctgagatgtacaggctgagtattttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system