KEGG   Bacillus subtilis subsp. subtilis 168: BSU15130Help
Entry
BSU15130          CDS       T00010                                 

Gene name
yllB
Definition
(RefSeq) protein MraZ
  KO
K03925  
MraZ protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1580121..1580552
Genome map
AA seq 143 aa AA seqDB search
MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGLDQCLFGYPMHEWKQIEEKLKALPL
TKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELWSKVIW
EQYTEEQEDSFAEIAENMIGFDI
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgggtgaatatcagcataccatcgatgcgaaaggccgcatgatcgtacccgct
aaattcagagaaggcctaggtgagcaatttgtgctgactagaggacttgaccaatgtctc
ttcggctaccctatgcacgaatggaaacaaattgaagaaaaactaaaagctcttcctctc
acaaagaaagatgcccgcgcgtttacccgtttcttcttttcaggggcgactgaatgcgaa
ctggataagcaaggcagggtaaatatcgcatcatctctattgaattacgccaaactggaa
aaagaatgtgttgttatcggggtttctaatcgaattgaattgtggagtaaagtaatttgg
gaacaatacacagaagagcaagaagattcatttgctgaaattgctgaaaacatgattggg
tttgatatataa

DBGET integrated database retrieval system