KEGG   Bacillus subtilis subsp. subtilis 168: BSU15180Help
Entry
BSU15180          CDS       T00010                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bsu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bsu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1586330..1587814
Genome map
AA seq 494 aa AA seqDB search
MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVEN
GAAAIVAEREVDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMV
DEILKKAGKRTGLIGTMYMKIGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSH
ALSLGRVHGCDYDIAVFTNLTQDHLDYHKTMDEYRHAKSLLFSQLGGAFNHEHPKRAVLN
ADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGTSFDLVTNKGTKHITMSLVGQ
FNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIVDYAHTPDSLE
NVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVA
ARAIVELNKNKTNS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacaaagctgcttacatacttaacaaccgaaccttctgtaaacgactcacaa
gaccctgaaataacttcaattgagatggactccagggaagtaaagaaagggagtcttttt
gtatgtgtaaaagggtatacggtggatggccacgattttgcgcaaaaagcagtagaaaac
ggtgcagcggctattgtggcagaaagagaggtcgatgtgaatgttcctgttattattgtc
cggcagtcacttcgcgcgctcagcgttttgtctgatgcgttttacggacagccgacgaag
aagcttcagctgattgggataacagggacaaacggcaaaacatcaacgacccacatggtc
gatgagattctgaaaaaagcgggaaaacgcacaggcttgatcggtacaatgtacatgaaa
atcggagacgaaacacttcctgttaaaaacacgactccggaaagcgtcacgctgcagaaa
acgtttaagaaaatgaatgacaagcacgttgacactgcaatcatggaggtttcttcccac
gctttgtctttaggacgcgtccatggctgtgattatgatattgccgtgtttacgaattta
acacaggaccatctggactatcataaaacgatggatgagtaccggcatgcaaaaagcttg
ctcttttcccaacttggcggggctttcaaccatgaacatccaaagcgtgccgtcctgaat
gctgacgatgaggcgagcgcttattttgaaaaggtaacagctgcgcatatctctacatac
ggaattaaaaacgatgctgatgtgatggcgaagaacatcagtatcactgcacagggcaca
agctttgatctcgtgacaaacaaaggcacgaagcacatcacgatgtctctcgtcggacaa
tttaatgtgtataacgtgctggccgctgttgcgacatgtattgcagcaggcataccgttt
gaaatcatcactgaggctgttgaagaattgcatggtgtaagaggccgttttgaattggtc
aatcagcagcaggagtttcctgtcattgtagactacgcgcacacaccggacagccttgaa
aatgtgctggagacatgcagagacatgacggaaggaaagctatttgtcgttgtcggctgc
ggaggagacagagataagacgaagcgcccgaaaatggctaaaattgctgtggagctggct
gacgagccgattttcacgtcagataacccgagaagcgaagatcctcgcgcgattttaaga
gatatggaagccggagtagagaacgcatactatcacagtattgcaaaccgcgagcaggcg
atctttttcgcaattgccaatgccaaaaaaggcgacgttgtcctcattgccggaaaagga
catgaaacctatcagcagatcggaaatgaaactttcgattttgatgatgctgaagtagcg
gcgagagccattgttgaactcaataagaataagacgaattcatag

DBGET integrated database retrieval system