KEGG   Bacillus subtilis subsp. subtilis 168: BSU15290Help
Entry
BSU15290          CDS       T00010                                 

Gene name
ftsZ
Definition
(RefSeq) cell division protein FtsZ
  KO
K03531  
cell division protein FtsZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Chromosome [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15290 (ftsZ)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Bacterial microtubules homologs
   BSU15290 (ftsZ)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU15290 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
1597832..1598980
Genome map
AA seq 382 aa AA seqDB search
MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQ
IGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQI
AKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPML
EAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEA
AKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINE
NLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRH
TSQPADDTLDIPTFLRNRNKRG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttggagttcgaaacaaacatagacggcttagcatcaattaaagtaatcggagtagga
ggcggcggtaacaacgccgttaaccgaatgattgaaaatgaagtgcaaggagtagagtat
atcgcggtaaacacggacgctcaagctcttaacctgtcaaaagcagaagtgaaaatgcaa
atcggcgcaaagctgactagaggattgggagcaggtgcgaatccggaagtcgggaaaaaa
gccgctgaagaaagcaaagagcagattgaagaagcacttaaaggtgctgacatggtattc
gtgacagctggtatgggcggcggaacaggaacaggtgccgcaccggttatcgcacaaatc
gcgaaagacttaggcgcattaacagtcggcgttgtgacaagaccgtttaccttcgaagga
cgcaaaagacagcttcaggctgcaggcggaatctcggcaatgaaagaagcggtggataca
ctgatcgtgatcccgaacgaccgtatccttgaaattgttgataaaaacacaccgatgctt
gaagcattccgcgaagcggataacgtacttcgccaaggggttcaaggtatttctgacttg
attgctacacctggtcttatcaaccttgactttgctgatgtgaaaacaatcatgtcaaac
aaaggatctgctttgatgggtatcggtattgctactggggaaaatcgcgcggcagaggca
gcaaaaaaagcaatttccagcccgcttcttgaagcggccattgacggtgcgcaaggcgtc
ctcatgaacatcactggaggaacaaacctcagcctatatgaggttcaggaagcagcagac
attgtcgcttcggcgtctgatcaagacgtaaacatgattttcggttctgttattaatgaa
aatctaaaagatgagattgtggtgacagtgattgcaaccggctttatcgaacaagagaag
gacgtgacgaagcctcagcgtccaagcttaaatcaaagcatcaaaacacacaatcaaagt
gttccgaagcgtgagccaaaacgtgaggaacctcagcagcagaacacagtaagccgtcat
acttcacagccggctgatgatacgcttgacatcccgacattcttaagaaaccgtaataaa
cgcggctaa

DBGET integrated database retrieval system