KEGG   Bacillus subtilis subsp. subtilis 168: BSU15290Help
Entry
BSU15290          CDS       T00010                                 

Gene name
ftsZ
Definition
(RefSeq) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15290 (ftsZ)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BSU15290 (ftsZ)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU15290 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 935971
NCBI-ProteinID: NP_389412
Pasteur: BG10232
BSORF: BG10232
UniProt: P17865
Structure
PDB: 

Jmol
Position
1597832..1598980
Genome map
AA seq 382 aa AA seqDB search
MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQ
IGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQI
AKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPML
EAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEA
AKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINE
NLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRH
TSQPADDTLDIPTFLRNRNKRG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttggagttcgaaacaaacatagacggcttagcatcaattaaagtaatcggagtagga
ggcggcggtaacaacgccgttaaccgaatgattgaaaatgaagtgcaaggagtagagtat
atcgcggtaaacacggacgctcaagctcttaacctgtcaaaagcagaagtgaaaatgcaa
atcggcgcaaagctgactagaggattgggagcaggtgcgaatccggaagtcgggaaaaaa
gccgctgaagaaagcaaagagcagattgaagaagcacttaaaggtgctgacatggtattc
gtgacagctggtatgggcggcggaacaggaacaggtgccgcaccggttatcgcacaaatc
gcgaaagacttaggcgcattaacagtcggcgttgtgacaagaccgtttaccttcgaagga
cgcaaaagacagcttcaggctgcaggcggaatctcggcaatgaaagaagcggtggataca
ctgatcgtgatcccgaacgaccgtatccttgaaattgttgataaaaacacaccgatgctt
gaagcattccgcgaagcggataacgtacttcgccaaggggttcaaggtatttctgacttg
attgctacacctggtcttatcaaccttgactttgctgatgtgaaaacaatcatgtcaaac
aaaggatctgctttgatgggtatcggtattgctactggggaaaatcgcgcggcagaggca
gcaaaaaaagcaatttccagcccgcttcttgaagcggccattgacggtgcgcaaggcgtc
ctcatgaacatcactggaggaacaaacctcagcctatatgaggttcaggaagcagcagac
attgtcgcttcggcgtctgatcaagacgtaaacatgattttcggttctgttattaatgaa
aatctaaaagatgagattgtggtgacagtgattgcaaccggctttatcgaacaagagaag
gacgtgacgaagcctcagcgtccaagcttaaatcaaagcatcaaaacacacaatcaaagt
gttccgaagcgtgagccaaaacgtgaggaacctcagcagcagaacacagtaagccgtcat
acttcacagccggctgatgatacgcttgacatcccgacattcttaagaaaccgtaataaa
cgcggctaa

DBGET integrated database retrieval system