KEGG   Bacillus subtilis subsp. subtilis 168: BSU15540Help
Entry
BSU15540          CDS       T00010                                 

Gene name
pyrD
Definition
dihydroorotate dehydrogenase B
Orthology
K17828  
dihydroorotate dehydrogenase (NAD+) catalytic subunit [EC:1.3.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bsu00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1627718..1628653
Genome map
AA seq 311 aa AA seqDB search
MLEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLSCLGAIMIKATTKEPRFGNPTPRVAE
TGAGMLNAIGLQNPGLDSVLHHELPWLEQFDTPIIANVAGSQVDDYVEVAEHISKAPNVH
ALELNISCPNVKTGGIAFGTNPEMAADLTKAVKEVSDVPVYVKLSPNVANITEIALAIEE
AGADGLTMINTLIGMRLDLKTGKPILANKTGGLSGPAVKPVAIRMVYEVSQMVNIPIIGM
GGVQTAEDALEFLLAGASAVAVGTANFVNPFACPEIIEQLPSVLLQYGYQSIEECIGRSW
NHEKQPAHHRA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctagaggtgaaattgccgggacttgatttgaaaaacccaatcattcctgcatcaggc
tgcttcggttttggaaaagaattttcacgtttttatgatttgtcttgtcttggagctatc
atgattaaggctacgacaaaggagccgcgctttgggaatccgacgccgcgggtagctgag
actggtgctggaatgctcaatgcgatcggtctccaaaatccggggctggatagtgtgttg
catcatgagctgccgtggcttgagcagtttgatacaccgatcattgccaatgtcgcaggt
tctcaagtcgatgattatgttgaagtcgcagaacatatcagcaaagcgcctaatgttcat
gctcttgaattgaatatttcctgcccgaatgtgaaaacaggcggaatcgcttttggcacg
aatcctgaaatggctgccgatttgacaaaagcggtgaaagaggtttcggatgtacccgtt
tatgtgaagctatccccgaacgtggctaatatcacagaaattgcattagcgatcgaggaa
gcgggagcggacggtcttacgatgatcaacacactaatcggcatgagactcgatttaaaa
accggcaaaccgatattagcgaataaaacagggggactttcgggccctgctgtgaagccg
gttgccattcgcatggtgtatgaagtcagccagatggtcaacatcccgattatcggaatg
ggaggcgtgcaaacggctgaagatgccctggaatttcttctcgcgggagcaagcgcagtc
gctgtcggaacagcaaactttgtgaatccttttgcatgtccagagattattgaacagctc
ccatctgttttgctccaatacggctatcaatcaattgaagaatgcatcggaaggagctgg
aatcatgaaaaacaacctgcccatcatcgcgcttga

DBGET integrated database retrieval system