KEGG   Bacillus subtilis subsp. subtilis 168: BSU16420Help
Entry
BSU16420          CDS       T00010                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bsu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bsu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1711736..1712809
Genome map
AA seq 357 aa AA seqDB search
MIRVLVVDDSAFMRKMISDFLTEEKQIEVIGTARNGEEALKKIELLKPDVITLDVEMPVM
NGTDTLRKIIEIYNLPVIMVSSQTEKGKECTINCLEIGAFDFITKPSGSISLDLYKIKEQ
LVERVVAAGLSGKRKRPVSQTVRPEPIVRAVVKPELSKPKPGTGRQIVCIGTSTGGPRAL
QKVIPKLPKDLNAPVVVVQHMPEGFTASLADRLNHLSDIQVKEAKDGEAALNGCVYIAPG
GKNISVIKNSEGLQVVLDNHDTPSRHKPSADYLFRSVGKLTDYEKVAVIMTGMGSDGTAG
LKDMLTAGNVKAIAESEESCVVYGMPKAAVKAGLIHEIKHVEDIAASITSCVKKERV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtgtgcttgtagttgatgattcagcttttatgagaaaaatgataagtgatttt
ctgaccgaagaaaagcagatagaagtaatcggaactgcgagaaacggagaagaagcgctt
aagaagattgaattattaaaaccggatgttattactcttgatgttgaaatgccggtcatg
aatgggacagatacgctccgcaaaattattgagatttataacttgccggtcattatggtg
tctagccagaccgagaaaggtaaagaatgcacaattaattgtttggagatcggtgccttt
gactttatcacaaagccatcaggctcaatatctctggatctatacaaaattaaagaacaa
ctagttgagcgtgtcgtcgcggcaggactttccggcaagcggaaacgtcctgtttcccag
acagttcggcccgaacctattgtgcgtgctgtcgttaagcctgaattaagcaaaccgaaa
cctggcacgggcagacaaattgtgtgtatcggcacatcaacaggcggtccacgggcgtta
caaaaggtgataccgaagctccctaaggatttgaacgcaccagtggttgtcgttcagcac
atgcctgaagggtttactgcttctttggctgatcggctgaatcatttatctgacattcag
gtaaaagaagcaaaagatggtgaagcagctcttaacggctgtgtttacatagcaccgggc
ggaaaaaacatatccgttattaaaaacagcgaaggactccaggttgtgcttgataaccat
gacacaccaagccgtcataaaccatctgctgattatttattccgttctgtcgggaaactg
acagattatgaaaaagtagcggttatcatgaccggaatgggcagtgacggcactgctgga
ctaaaggacatgctaacagccggcaatgtgaaagccattgcggagtctgaagaatcttgt
gtcgtatacgggatgccaaaagctgctgttaaagcgggtctcattcatgagattaaacat
gtggaagatatcgcagcatccatcacaagctgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system