KEGG   Bacillus subtilis subsp. subtilis 168: BSU16420Help
Entry
BSU16420          CDS       T00010                                 

Gene name
cheB
Definition
(RefSeq) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU16420 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BSU16420 (cheB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BSU16420 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     BSU16420 (cheB)
Two-component system [BR:bsu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BSU16420 (cheB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16420 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-GeneID: 940124
NCBI-ProteinID: NP_389524
Pasteur: BG10255
BSORF: BG10255
UniProt: Q05522
Position
1711736..1712809
Genome map
AA seq 357 aa AA seqDB search
MIRVLVVDDSAFMRKMISDFLTEEKQIEVIGTARNGEEALKKIELLKPDVITLDVEMPVM
NGTDTLRKIIEIYNLPVIMVSSQTEKGKECTINCLEIGAFDFITKPSGSISLDLYKIKEQ
LVERVVAAGLSGKRKRPVSQTVRPEPIVRAVVKPELSKPKPGTGRQIVCIGTSTGGPRAL
QKVIPKLPKDLNAPVVVVQHMPEGFTASLADRLNHLSDIQVKEAKDGEAALNGCVYIAPG
GKNISVIKNSEGLQVVLDNHDTPSRHKPSADYLFRSVGKLTDYEKVAVIMTGMGSDGTAG
LKDMLTAGNVKAIAESEESCVVYGMPKAAVKAGLIHEIKHVEDIAASITSCVKKERV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtgtgcttgtagttgatgattcagcttttatgagaaaaatgataagtgatttt
ctgaccgaagaaaagcagatagaagtaatcggaactgcgagaaacggagaagaagcgctt
aagaagattgaattattaaaaccggatgttattactcttgatgttgaaatgccggtcatg
aatgggacagatacgctccgcaaaattattgagatttataacttgccggtcattatggtg
tctagccagaccgagaaaggtaaagaatgcacaattaattgtttggagatcggtgccttt
gactttatcacaaagccatcaggctcaatatctctggatctatacaaaattaaagaacaa
ctagttgagcgtgtcgtcgcggcaggactttccggcaagcggaaacgtcctgtttcccag
acagttcggcccgaacctattgtgcgtgctgtcgttaagcctgaattaagcaaaccgaaa
cctggcacgggcagacaaattgtgtgtatcggcacatcaacaggcggtccacgggcgtta
caaaaggtgataccgaagctccctaaggatttgaacgcaccagtggttgtcgttcagcac
atgcctgaagggtttactgcttctttggctgatcggctgaatcatttatctgacattcag
gtaaaagaagcaaaagatggtgaagcagctcttaacggctgtgtttacatagcaccgggc
ggaaaaaacatatccgttattaaaaacagcgaaggactccaggttgtgcttgataaccat
gacacaccaagccgtcataaaccatctgctgattatttattccgttctgtcgggaaactg
acagattatgaaaaagtagcggttatcatgaccggaatgggcagtgacggcactgctgga
ctaaaggacatgctaacagccggcaatgtgaaagccattgcggagtctgaagaatcttgt
gtcgtatacgggatgccaaaagctgctgttaaagcgggtctcattcatgagattaaacat
gtggaagatatcgcagcatccatcacaagctgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system