KEGG   Bacillus subtilis subsp. subtilis 168: BSU17870Help
Entry
BSU17870          CDS       T00010                                 

Gene name
yneB
Definition
(RefSeq) resolvase YneB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase PepSY_2 HTH_32
Motif
Other DBs
NCBI-GeneID: 939557
NCBI-ProteinID: NP_389670
Pasteur: BG11821
BSORF: BG11821
UniProt: Q45057
Position
1918742..1919395
Genome map
AA seq 217 aa AA seqDB search
MKALIYARVSTNKEQQETSLKRQEEELTAIAAENGMEVVKVISEKASGYEMDRDGVFELL
DEIKNADIDVILVQDETRLGRGNAKIALLHCIYREGVKVYTTAHRGELELSEADSMVLEI
VSIVEEYQRKIHNMKIRRGMKRAVKNGFKPQKNLKNQHGNSGKEKIEVPISEIVRLRANK
LTFAEIAATLRGFGYDVSKATVHRRFQEYIENEETAE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactcatttatgcccgtgtaagcacaaataaagaacagcaggaaacgtcatta
aagcggcaggaggaggagcttacggccattgcagcggagaacggcatggaagtggtcaaa
gtgatttcagaaaaagccagcggatatgaaatggatcgggatggtgtatttgagctgctc
gatgagattaagaacgctgatattgatgtcattttggttcaggatgagacaaggctcgga
cggggaaacgcaaaaatcgcactgcttcattgtatttatagagaaggtgtgaaagtctat
acaacggctcatagaggtgaactggagttatcggaggctgactcaatggtcttggaaatc
gtcagcattgtggaagagtatcagcgaaagattcacaacatgaaaatcagacggggaatg
aaacgtgcagtaaaaaacggttttaaaccgcaaaaaaacttaaaaaaccaacatgggaac
agtggaaaagaaaaaatagaggtgccaatctcagagatcgtccgcctgagagcgaataaa
ctgacgtttgctgaaatcgcggctaccctaagagggtttggctatgatgtctctaaagca
accgttcaccggcgttttcaggaatacatagagaatgaagagactgcagagtga

DBGET integrated database retrieval system