KEGG   Bacillus subtilis subsp. subtilis 168: BSU17870Help
Entry
BSU17870          CDS       T00010                                 

Gene name
yneB
Definition
(RefSeq) resolvase homolog YneB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1918742..1919395
Genome map
AA seq 217 aa AA seqDB search
MKALIYARVSTNKEQQETSLKRQEEELTAIAAENGMEVVKVISEKASGYEMDRDGVFELL
DEIKNADIDVILVQDETRLGRGNAKIALLHCIYREGVKVYTTAHRGELELSEADSMVLEI
VSIVEEYQRKIHNMKIRRGMKRAVKNGFKPQKNLKNQHGNSGKEKIEVPISEIVRLRANK
LTFAEIAATLRGFGYDVSKATVHRRFQEYIENEETAE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactcatttatgcccgtgtaagcacaaataaagaacagcaggaaacgtcatta
aagcggcaggaggaggagcttacggccattgcagcggagaacggcatggaagtggtcaaa
gtgatttcagaaaaagccagcggatatgaaatggatcgggatggtgtatttgagctgctc
gatgagattaagaacgctgatattgatgtcattttggttcaggatgagacaaggctcgga
cggggaaacgcaaaaatcgcactgcttcattgtatttatagagaaggtgtgaaagtctat
acaacggctcatagaggtgaactggagttatcggaggctgactcaatggtcttggaaatc
gtcagcattgtggaagagtatcagcgaaagattcacaacatgaaaatcagacggggaatg
aaacgtgcagtaaaaaacggttttaaaccgcaaaaaaacttaaaaaaccaacatgggaac
agtggaaaagaaaaaatagaggtgccaatctcagagatcgtccgcctgagagcgaataaa
ctgacgtttgctgaaatcgcggctaccctaagagggtttggctatgatgtctctaaagca
accgttcaccggcgttttcaggaatacatagagaatgaagagactgcagagtga

DBGET integrated database retrieval system