KEGG   Bacillus subtilis subsp. subtilis 168: BSU18180Help
Entry
BSU18180          CDS       T00010                                 

Gene name
yngB
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase YngB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU18180 (yngB)
   00052 Galactose metabolism
    BSU18180 (yngB)
   00500 Starch and sucrose metabolism
    BSU18180 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU18180 (yngB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSU18180 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-GeneID: 936791
NCBI-ProteinID: NP_389700
Pasteur: BG13453
BSORF: BG13453
UniProt: O31822
Position
1946702..1947595
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQ
GHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCR
KEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggttatacccgcagcgggtttaggaacgagatttctg
ccggcgacaaaggcgcagcctaaagaaatgcttccaatcgtcgacaaaccagcaatccaa
tatattgtagaagaggccgcagagtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgatcggtcggcggaattggaattcaatctccgg
gaaaaaggcaagacggagacacttaaggaaatgcagcagattgccgatttggccaacatt
cattacatccgccagaaagaaccgctcggattaggccatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgctgttctcttaggtgatgatattatggtgtctgaaaca
ccggctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgta
cagtcagttctccctgaggatgtcagcaaatatggtattataaatacatcagggtctcaa
gggcatgtatatgaagtgaacgatttagtggaaaagccttctcctgaagaagcaccttcg
gaaatcgcagtaatgggacgttatgtgctgaattcttcgatcttctccgttttgaagaca
attggcagaggcgcgggcaacgaaattcagctgacagatgcgcttcgtgaggtttgccgt
aaggagccgatccatgcccggctgctggaaggaaatcgatatgacattggcgataagctg
ggctgttttaaagcgagcaccgaaatcggcttaatgcgtcccgaaatgagatctcagctt
ttggcctatttagaagatgtgatcaaacgggaaacgaaagaaatgctgcggtaa

DBGET integrated database retrieval system