KEGG   Bacillus subtilis subsp. subtilis 168: BSU18470Help
Entry
BSU18470          CDS       T00010                                 

Gene name
proJ
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSU18470 (proJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU18470 (proJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BSU18470 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2015733..2016848)
Genome map
AA seq 371 aa AA seqDB search
MTPDTSMKRVVVKIGSSSLTSLHGEISIRKLEALVDQVVKLKDAGYEVILVSSGAVAAGY
RKLGFIQRPEKLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYNNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDG
NPRTNPEAKKIQRVSEITPDIEACAGDTGSIVGTGGMRSKLDAFKIVMASGIKGFLGQAD
AGDILYHAVHEQAEGTYFEAEGTLPLNQKEQWIAFNSGPEGEMILSDDCSRKITNGQSSL
YLDGVQKIKGKFKSGSVVRLMDSKGTEIGLGIVNYSSVQLQEPEKKKELTNRALIDQEAF
VCHVDFSLPVN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctgatacaagcatgaaaagagtcgttgtgaagattggaagcagttcattaaca
agccttcatggagaaatcagcattcgaaaattagaagcgttggtcgaccaggtcgtcaaa
ctcaaagacgccggttatgaagtgattttggtttcctcaggcgcagtggcggcgggatat
cggaagctcggatttatccaaaggcccgagaagcttccagaaaaacaagcatcagcttca
atcggccagggattgctaatggaggcttattcaaagctgtttttggcacacggctatgtc
gcatcccaaattttaattacgagaagcgatttttctgatgaatatcgatacaacaatgtc
aggaatacaatgaatgtactgctcgagcgcggcatcatcccgatcataaacgaaaatgac
acagttaccgtcaatcggctcaagtttggcgacaatgatacgctcgcagcaaaagtcgca
ggattgattgatgcagatatgcttgtgattttatcagatatagacggattatatgacggc
aatccgcgcacaaatccagaagcgaaaaagatacagcgggtgagtgaaataacacctgac
atcgaagcatgcgcaggtgacactggaagcatcgttggcaccggcggcatgcgctctaag
cttgatgcgtttaaaatcgtaatggcgtctggcattaaaggtttcctaggtcaggcagat
gctggcgatattttataccacgccgttcatgaacaggcggaaggcacctattttgaagca
gaaggaacgcttccgttgaatcaaaaggagcaatggatcgcttttaattccggtccggaa
ggtgaaatgattttatcagatgattgttcacgaaaaataacaaacggacaatcgagttta
tacctagacggtgtacagaagattaaagggaaattcaaaagcggttcagttgttcggctg
atggattcaaaagggacggaaatcggccttggaatcgtcaattactcttctgtacagctt
caagaaccggaaaagaaaaaggaactgacaaatagagctctaattgatcaagaagcattt
gtttgccatgtggatttttctttacctgtaaattaa

DBGET integrated database retrieval system