KEGG   Bacillus subtilis subsp. subtilis 168: BSU18470Help
Entry
BSU18470          CDS       T00010                                 

Gene name
proJ
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSU18470 (proJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU18470 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BSU18470 (proJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BSU18470 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2015733..2016848)
Genome map
AA seq 371 aa AA seqDB search
MTPDTSMKRVVVKIGSSSLTSLHGEISIRKLEALVDQVVKLKDAGYEVILVSSGAVAAGY
RKLGFIQRPEKLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYNNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDG
NPRTNPEAKKIQRVSEITPDIEACAGDTGSIVGTGGMRSKLDAFKIVMASGIKGFLGQAD
AGDILYHAVHEQAEGTYFEAEGTLPLNQKEQWIAFNSGPEGEMILSDDCSRKITNGQSSL
YLDGVQKIKGKFKSGSVVRLMDSKGTEIGLGIVNYSSVQLQEPEKKKELTNRALIDQEAF
VCHVDFSLPVN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctgatacaagcatgaaaagagtcgttgtgaagattggaagcagttcattaaca
agccttcatggagaaatcagcattcgaaaattagaagcgttggtcgaccaggtcgtcaaa
ctcaaagacgccggttatgaagtgattttggtttcctcaggcgcagtggcggcgggatat
cggaagctcggatttatccaaaggcccgagaagcttccagaaaaacaagcatcagcttca
atcggccagggattgctaatggaggcttattcaaagctgtttttggcacacggctatgtc
gcatcccaaattttaattacgagaagcgatttttctgatgaatatcgatacaacaatgtc
aggaatacaatgaatgtactgctcgagcgcggcatcatcccgatcataaacgaaaatgac
acagttaccgtcaatcggctcaagtttggcgacaatgatacgctcgcagcaaaagtcgca
ggattgattgatgcagatatgcttgtgattttatcagatatagacggattatatgacggc
aatccgcgcacaaatccagaagcgaaaaagatacagcgggtgagtgaaataacacctgac
atcgaagcatgcgcaggtgacactggaagcatcgttggcaccggcggcatgcgctctaag
cttgatgcgtttaaaatcgtaatggcgtctggcattaaaggtttcctaggtcaggcagat
gctggcgatattttataccacgccgttcatgaacaggcggaaggcacctattttgaagca
gaaggaacgcttccgttgaatcaaaaggagcaatggatcgcttttaattccggtccggaa
ggtgaaatgattttatcagatgattgttcacgaaaaataacaaacggacaatcgagttta
tacctagacggtgtacagaagattaaagggaaattcaaaagcggttcagttgttcggctg
atggattcaaaagggacggaaatcggccttggaatcgtcaattactcttctgtacagctt
caagaaccggaaaagaaaaaggaactgacaaatagagctctaattgatcaagaagcattt
gtttgccatgtggatttttctttacctgtaaattaa

DBGET integrated database retrieval system