KEGG   Bacillus subtilis subsp. subtilis 168: BSU18840Help
Entry
BSU18840          CDS       T00010                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2054599..2055240)
Genome map
AA seq 213 aa AA seqDB search
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNA
WKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaatttcttagttggattatcggcagctttaatgagtattagc
ttgttttcggcaaccgcctctgcagctagcacagactactggcaaaattggactgatggg
ggcggtatagtaaacgctgtcaatgggtctggcgggaattacagtgttaattggtctaat
accggaaattttgttgttggtaaaggttggactacaggttcgccatttaggacgataaac
tataatgccggagtttgggcgccgaatggcaatggatatttaactttatatggttggacg
agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactgga
acgtataaaggtactgtaaaaagtgatgggggtacatatgacatatatacaactacacgt
tataacgcaccttccattgatggcgatcgcactacttttacgcagtactggagtgttcgc
cagtcgaagagaccaaccggaagcaacgctacaatcactttcagcaatcatgtgaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttaccaagtcatggcgacagaa
ggatatcaaagtagtggaagttctaacgtaacagtgtggtaa

DBGET integrated database retrieval system