KEGG   Bacillus subtilis subsp. subtilis 168: BSU19360Help
Entry
BSU19360          CDS       T00010                                 

Gene name
odhB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSU19360 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU19360 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BSU19360 (odhB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BSU19360 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2107505..2108758)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKTESKESVKEEKQAEPAAQEVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaaacagaaagcaaggaaagcgtaaaagaagag
aaacaggctgaaccagctgcacaagaggtgagcgaggaagcacaatctgaagcaaaatca
agaacgatcgcttctccgtcggcccgtaagcttgcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgcttggaagagtgcgcaagcaggatgtcgaagcgtacgaa
aaaccggcatcaaaaccggctcctcagcaaaagcagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgttgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtacagcaaacatcagcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattttttgagcaaaatgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtggctgcattgaaaaaatat
ccgctgttgaatgcagaaattcaaggcgatgagttgatcgttaaaaaattctacgatatc
ggaatcgctgttgctgctgatgaaggtcttgtcgttccggttgtacgggatgcggatcgc
ctgacatttgcaggaatcgaaaaagagatcggcgagcttgcgaaaaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggctccttcacgattacaaacggagggactttc
ggttcattgatgtcaactccaattttaaacagcccgcaagtcggtatactgggcatgcat
aagattcagctgcgccctgtagccattgatgaagagcgtttcgaaaaccgtccgatgatg
tatatcgctttatcttatgatcaccgaattgtagacggtaaagaagcggttggtttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system