KEGG   Bacillus subtilis subsp. subtilis 168: BSU20020Help
Entry
BSU20020          CDS       T00010                                 

Gene name
yosS
Definition
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase YosS
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU20020 (yosS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     BSU20020 (yosS)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU20020 (yosS)
 Prokaryotic Type
    BSU20020 (yosS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase DCD PapG_N
Motif
Other DBs
NCBI-GeneID: 939536
NCBI-ProteinID: NP_389883
Pasteur: BG13728
BSORF: BG13728
UniProt: O34919
Structure
PDB: 

Jmol
Position
complement(2159268..2159696)
Genome map
AA seq 142 aa AA seqDB search
MQIKIKYLDETQTRINKMEQGDWIDLRAAEDVAIKKDEFKLVPLGVAMELPEGYEAHVVP
RSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTKIKKGDRICQFRIMKKMPAV
DLIEVDRLGNGDRGGHGSTGTK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaaatcaaatacttagatgaaacacaaacaagaattaacaaaatggagcaa
ggtgattggattgatcttcgtgcagctgaagatgtagcgatcaaaaaagatgaatttaaa
cttgttccattgggagtggccatggaattgcctgaaggttacgaagcacatgtcgttcct
cgttcgagtacgtataagaactttggtgtgattcaaacaaactcaatgggtgttatcgat
gagtcttataagggtgacaacgatttttggttctttcctgcttatgcgttacgtgacaca
aagattaagaaaggggatcgaatctgccagttcagaattatgaagaagatgccggcagtt
gacttgatcgaggtagaccgtctaggcaacggtgaccgaggtgggcacggatcaactgga
acgaagtaa

DBGET integrated database retrieval system