KEGG   Bacillus subtilis subsp. subtilis 168: BSU21470Help
Entry
BSU21470          CDS       T00010                                 

Gene name
sunT
Definition
(RefSeq) sublancin-168-processing and transport ATP-binding protein SunT
  KO
K06148  
ATP-binding cassette, subfamily C, bacterial
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU21470 (sunT)
Transporters [BR:bsu02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BSU21470 (sunT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2267346..2269463)
Genome map
AA seq 705 aa AA seqDB search
MNKKKKYVHTKQFNSHDCGLACISSILKFHNLNYGIDFLLDLIGDKEGYSLRDLIVIFKK
MGIKTRPLELQENKTFEALKQIKLPCIALLEGEEYGHYITIYEIRNNYLLVSDPDKDKIT
KIKKEDFESKFTNFILEIDKESIPEKEKDQKKHSYFFKDILFRNKLIVFVILLTSLFVVG
LAVAGSFYIKFLVDLIIPRSLRESLITITLIFISMVLIRCIFDFVRSYLIIKLSYKVDKE
MSNVYFNKVTKLPINFFENREDGEVISRFNDGIYIKDFFSANFVTAIIDIILILGLGVIL
YRTNNILFLTIILPILLLSCLAILFFDHLKKKNQKLMEDKAKSTSLLINFLKNMTTVYSL
NKTSFFLEKFHLTYDKQLNSTFSVAKAVISNEILKGLIQNSFTIIILWVGTRQVLNDSMS
LGTLLFINTLAAFLLSSLDRILSMQSDLQQAHVASIRFFDVVNYPVQQDSNENLTELDFI
QNIKTVNLNIGADPMRYIVEDINLILDRKDKVLIIGESGTGKSTFAKSLSKLYKVPDKSI
YLNGLDINRYDHLSIRKRIVYIDENPFLFKGTIKENLCMGEIFDQNEIENACIMSQCHEF
ICNLDKQYSYKLSENGSNLSTGQKQRLALARAILHQPQVLILDESLSNIDPDNTKLIYET
LHRMDCLIILITHNDPSNFKYNKKLVFRNNRIIESSYSENKEYSI
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagaaaaagaaatatgttcatactaaacagtttaatagtcatgattgtggacta
gcttgtatctcgtcaattttaaagtttcataaccttaactatggaattgatttcttacta
gacctaattggggataaggaaggctatagtttaagagacttaattgttatttttaagaag
atggggataaaaactaggccacttgaattgcaagaaaataagacattcgaagccctaaaa
caaataaagctcccttgtatagctttgttagaaggggaggaatatggacattacataaca
atatacgaaattagaaataactatttacttgttagtgatcctgataaagacaaaataact
aaaataaaaaaagaggattttgaaagtaaattcacaaactttatattagaaattgacaaa
gagtcaattcctgaaaaagaaaaagatcaaaaaaaacattcttacttttttaaggacata
ctttttagaaataaattgatcgtttttgtgattttattgacttccttgttcgttgtgggt
cttgctgtagctgggtcgttttatataaagtttctagttgacctaattatcccaagaagc
ttaagagaatctttaatcacaatcactttaatattcataagtatggtcttaataaggtgc
atcttcgattttgtaagatcatatttgataataaaattgtcttacaaagttgataaagag
atgtcaaatgtttattttaataaagtaacaaaattacctattaatttttttgaaaacaga
gaagatggagaggtaatttctcgattcaatgatggtatatatattaaagacttttttagt
gctaactttgttactgcaataattgatataattttaatactgggattaggagttatttta
tatagaacaaataacattcttttcttaacaattattctcccgattttgctactttcatgt
ctagcgattttgttttttgatcatcttaaaaagaaaaatcaaaaactgatggaggataag
gctaaatctacctctcttttaattaattttctgaagaatatgacaactgtttattcttta
aataaaacctcgttttttttagaaaaatttcatcttacatatgataaacaattaaattca
acctttagtgtagcaaaggcagttattagcaatgaaatactaaaaggattaattcaaaac
tcttttacaataattatcctatgggttgggacaagacaagttctaaatgattcaatgagt
ttgggtacactgctatttataaacacattagcagcctttttgctaagttcactagatcgt
atattgagtatgcaatcagatcttcagcaggcacatgttgcttccataagattttttgac
gtagtaaactatccagttcagcaagatagcaatgagaatttaactgaacttgattttatt
cagaatatcaaaacagttaatcttaatattggggcagacccaatgcgttatatagttgaa
gatattaatttaatattagacagaaaggataaagtccttattattggagaaagtggtact
ggaaaaagtacgtttgcaaaaagtttgtctaaattgtataaagtacccgataagtcaatt
tatttaaatggattagatattaatcgatacgatcatttatcaataagaaaaaggattgta
tatattgacgaaaatccttttctttttaagggaaccattaaagagaatctttgcatggga
gagatttttgatcagaacgaaattgaaaacgcgtgtataatgtcccaatgccatgaattc
atttgtaacttggacaagcagtacagttataaattgtctgaaaacggttccaatctatct
acaggacaaaaacaacggttagcattagcaagagcaattttacatcaaccacaagtatta
attttagatgagtcattatctaacattgatccggataacacaaaattgatttatgaaacc
ttacacaggatggattgtttaattattcttataactcataatgacccaagtaacttcaaa
tacaataaaaaattagtattcagaaacaataggattatagagtcgagctactcggaaaat
aaggagtattctatatga

DBGET integrated database retrieval system