KEGG   Bacillus subtilis subsp. subtilis 168: BSU22560Help
Entry
BSU22560          CDS       T00010                                 

Gene name
qcrA
Definition
(RefSeq) menaquinol-cytochrome c reductase iron-sulfur subunit
  KO
K03886  
menaquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    BSU22560 (qcrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.-  
     BSU22560 (qcrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2364589..2365092)
Genome map
AA seq 167 aa AA seqDB search
MGGKHDISRRQFLNYTLTGVGGFMAASMLMPMVRFALDPVLKSTGKQDMVQVVSVDELTK
EPQRFDFKINQVDAWYESEESRSAWVFKNGDEIVALSPICKHLGCTVNWNSDPKNPNKFF
CPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDGFLYLGKAKPKGEG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggcggaaaacatgatatatccagacgtcaatttttgaattatacgctcacaggcgta
ggaggttttatggcggctagtatgctcatgcctatggttcgcttcgcactcgacccggta
ttaaaatcgacagggaagcaggatatggttcaggttgtcagcgttgatgagttgacaaaa
gagccgcagcgctttgattttaaaattaatcaagtcgatgcctggtatgagtcagaagag
tcaagatcagcctgggtcttcaaaaacggggatgaaattgtagcactttcgccaatttgt
aagcatttagggtgtacggtgaactggaatagtgatcctaaaaacccgaataaattcttt
tgtccatgccattacggactctatgaaaaggacggcaccaatgtccctggcacgccgccg
cttgcgcctcttgatcattatgagcaagaagtaaaagacggcttcctgtatcttggaaaa
gcaaagcctaagggggaagggtga

DBGET integrated database retrieval system