KEGG   Bacillus subtilis subsp. subtilis 168: BSU22630Help
Entry
BSU22630          CDS       T00010                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSU22630 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU22630 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22630 (trpA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSU22630 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2371508..2372311)
Genome map
AA seq 267 aa AA seqDB search
MFKLDLQPSEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQR
ASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGL
LVPDLPLEESNSLQEECKSHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRN
EFNSSVYPFIRTVKNLSTVPVAVGFGISNREQVIKMNEISDGVVVGSALVRKIEELKDRL
ISAETRNQALQEFEDYAMAFSGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattggatcttcaaccatcagaaaaattgtttatcccgtttattacggcgggc
gatccagttcctgaggtttcgattgaactggcgaagtcactccaaaaagcaggcgccaca
gcattggagcttggtgttgcatactctgacccgcttgcagacggtccggtgatccagcgg
gcttcaaagcgggcgcttgatcaaggaatgaatatcgtaaaggcaatcgaattaggcgga
gaaatgaaaaaaaacggagtgaatattccgattatcctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcgggaaaatcatattgacggtctg
cttgttccggatctgccattagaagaaagcaacagccttcaagaggaatgtaaaagccat
gaggtgacgtatatttctttagttgcgccgacaagcgaaagccgtttgaaaaccattatt
gaacaagccgaggggttcgtctactgtgtatcttctctgggtgtgaccggtgtccgcaat
gagttcaattcatccgtgtacccgttcattcgtactgtgaagaatctcagcactgttccg
gttgctgtagggttcggtatatcaaaccgtgaacaggtcataaagatgaatgaaattagt
gacggtgtcgtagtgggaagtgcgctcgtcagaaaaatagaagaattaaaggaccggctc
atcagcgctgaaacgagaaatcaggcgctgcaggagtttgaggattatgcaatggcgttt
agcggcttgtacagtttaaaatga

DBGET integrated database retrieval system