KEGG   Bacillus subtilis subsp. subtilis 168: BSU22640Help
Entry
BSU22640          CDS       T00010                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSU22640 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU22640 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22640 (trpB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSU22640 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2372304..2373506)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGDFGGKFVPETLMQPLDEIQTAFKQIKDDPAFREEYYKLLKDYSGRPTA
LTYADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGV
AAATVAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEGTMPDKVVACVGGGSNA
MGMFQAFLNEDVELIGAEAAGKGIDTPLHAATISKGTVGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVDALKLLSEKEGILPAIESAHALAKA
FKLAKGMDRGQLILVCLSGRGDKDVNTLMNVLEEEVKAHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccgaatgaaataggcagatacggtgattttggcggaaagtttgttccg
gaaacactcatgcagccgttagatgaaatacaaacagcatttaaacaaatcaaggatgat
cccgcttttcgtgaagagtattataagctgttaaaggactattccggacgcccgactgca
ttaacatacgctgatcgagtcactgaatacttaggcggcgcgaaaatctatttgaaacga
gaagatttaaaccatacaggttctcataaaatcaataatgcgctaggtcaagcgctgctt
gctaaaaaaatgggcaaaacgaaaatcattgctgaaaccggtgccggccagcatggtgtt
gccgctgcaacagttgcagccaaattcggcttttcctgtactgtgtttatgggtgaagag
gatgttgcccgccagtctctgaacgttttccgcatgaagcttcttggagcggaggtagtg
cctgtaacaagcggaaacggaacattgaaggatgccacaaatgaggcgatccggtactgg
gttcagcattgtgaggatcacttttatatgattggatcagttgtcggcccgcatccttat
ccgcaagtggtccgtgaatttcaaaaaatgatcggagaggaagcgaaggatcagttgaaa
cgtattgaaggcactatgcctgataaagtagtggcatgtgtaggcggaggaagcaatgcg
atgggtatgtttcaggcatttttaaatgaagatgttgaactgatcggcgctgaagcagca
ggaaaaggaattgatacacctcttcatgccgccactatttcgaaaggaaccgtaggggtt
attcacggttcattgacttatctcattcaggatgagttcgggcaaattattgagccctac
tctatttcagccggtctcgactatcctggaatcggtccggagcatgcatatttgcataaa
agcggccgtgtcacttatgacagtataaccgatgaagaagcggtggatgcattaaagctt
ttgtcagaaaaagaggggattttgccggcaatcgaatctgcccatgcgttagcgaaagca
ttcaaactcgccaaaggaatggatcgcggtcaactcattctcgtctgtttatcaggccgg
ggagacaaggatgtcaacacattaatgaatgtattggaagaagaggtgaaagcccatgtt
taa

DBGET integrated database retrieval system