KEGG   Bacillus subtilis subsp. subtilis 168: BSU22650Help
Entry
BSU22650          CDS       T00010                                 

Gene name
trpF
Definition
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSU22650 (trpF)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22650 (trpF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BSU22650 (trpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2373487..2374134)
Genome map
AA seq 215 aa AA seqDB search
MKKPALKYCGIRSLKDLQLAAESQADYLGFIFAESKRKVSPEDVKKWLNQVRVEKQVAGV
FVNESIETMSRIAKSLKLDVIQLHGDEKPADAAALRKLTGCEIWKALHHQDNTTQEIARF
KDNVDGFVIDSSVKGSRGGTGVAFSWECVPEYQQAAIGKRCFIAGGVNPDSITRLLKWQP
EGIDLASGIEKNGQKDQNLMRLLEERMNRYVSISE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaccggcattaaaatattgcggtattcggtcactaaaggatttgcagcttgcg
gcggaatcacaggctgattacctaggatttatttttgctgaaagcaaacgaaaagtatct
ccggaagatgtgaaaaaatggctgaaccaagttcgtgtcgaaaaacaggttgcaggtgtt
tttgttaatgaatcaatagagacgatgtcacgtattgccaagagcttgaagctcgacgtc
attcagcttcacggtgatgaaaaaccggcggatgctgctgctcttcgcaagctgacaggc
tgtgaaatatggaaggcgcttcaccatcaagataacacaactcaagaaatagcccgcttt
aaagataatgttgacggctttgtgattgattcatctgtaaaagggtctagaggcggaact
ggtgttgcattttcttgggaatgtgtgccggaatatcagcaggcggctattggtaaacgc
tgctttatcgctggcggcgtgaatccggatagcatcacacgcctattgaaatggcagcca
gaaggaattgaccttgccagcggaattgaaaaaaacggacaaaaagatcagaatctgatg
aggcttttagaagaaaggatgaaccgatatgtatccatatccgaatga

DBGET integrated database retrieval system