KEGG   Bacillus subtilis subsp. subtilis 168: BSU22770Help
Entry
BSU22770          CDS       T00010                                 

Gene name
mtrB
Definition
(RefSeq) transcription attenuation protein MtrB
  KO
K06285  
transcription attenuation protein (tryptophan RNA-binding attenuator protein)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU22770 (mtrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2384534..2384761)
Genome map
AA seq 75 aa AA seqDB search
MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGE
ALIQTAYGEMKSEKK
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaagcattcaagtgattttgtcgtcattaaagccgttgaggacggagtgaat
gtgatcggcctgacaagaggaacagacacaaagtttcaccattccgaaaaactcgacaag
ggagaagtgatcatcgctcagtttacagagcatacttctgccattaaagtcagaggagag
gcactgattcaaaccgcgtacggagaaatgaaaagcgaaaaaaaataa

DBGET integrated database retrieval system