KEGG   Bacillus subtilis subsp. subtilis 168: BSU23150Help
Entry
BSU23150          CDS       T00010                                 

Gene name
resA
Definition
(RefSeq) thiol-disulfide oxidoreductase ResA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2420804..2421343)
Genome map
AA seq 179 aa AA seqDB search
MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDL
KGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVN
FPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGETSG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaaggcgtttattcattcggaccggcatccttctcgttttaatctgcgca
ctcggctataccatttacaacgctgtatttgccggcaaagagagtatatccgaagggtcc
gacgcaccgaattttgtcctagaggatacgaatgggaaacgtatcgagctcagtgactta
aaagggaaaggtgtttttttgaatttctggggtacatggtgtgaaccgtgcaaaaaagag
tttccttatatggcaaaccaatataagcattttaaaagccaaggtgttgaaattgtcgct
gtaaatgttggggagtcaaagatagcagtacataattttatgaaatcctacggagtcaat
ttcccggttgttctggatacagatcgccaagtgcttgatgcctatgacgtatctccgctt
ccgacaacctttttgatcaatccggaaggaaaagttgtcaaggtggtgaccggcactatg
acagaaagcatgatacacgattatatgaatctcataaaacccggagagacttcgggatga

DBGET integrated database retrieval system