KEGG   Bacillus subtilis subsp. subtilis 168: BSU24020Help
Entry
BSU24020          CDS       T00010                                 

Gene name
bmrR
Definition
MerR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
2495898..2496734
Genome map
AA seq 278 aa AA seqDB search
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLK
YIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPA
LGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYT
SIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYI
ADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatcgtattactcaattggggaagtatcaaaactggcaaacgtgtcgataaaa
gcgctccgttattacgataaaattgatttatttaaaccagcctacgtcgacccggatacc
agctaccgctattatacagattctcagctcattcatctggatttgatcaaatcattgaaa
tatatcggcacacctttagaagagatgaaaaaagcacaggacttagagatggaagaactg
tttgctttttatacagagcaggagaggcaaatcagggagaaattagactttttatcagcc
ctggagcaaaccatttcattggtgaaaaagcggatgaaacggcagatggaatatcccgcg
ctcggtgaggtgtttgttttagatgaagaagaaatacggatcattcagacagaggcagaa
ggaatcgggcctgaaaacgtgctcaacgcctcctacagcaaattaaaaaaatttatcgag
tcagcagatggatttacgaacaatagctacggcgctactttctcttttcagccctacacc
agcattgatgaaatgacttaccgtcatattttcacacctgtattgacgaataaacagatt
tcatcaattacgccggatatggaaatcacaacgatccctaaagggaggtatgcgtgtatc
gcgtataatttttcgcctgaacattattttctcaacttacagaagcttatcaaatatatc
gcggaccgccaattaacagttgtcagtgatgtatacgagttaatcataccgattcattac
tccccgaaaaaacaagaagaatatcgagtcgaaatgaaaatacggatcgctgaataa

DBGET integrated database retrieval system