KEGG   Bacillus subtilis subsp. subtilis 168: BSU24020Help
Entry
BSU24020          CDS       T00010                                 

Gene name
bmrR
Definition
(RefSeq) MerR family transcriptional regulator
  KO
K19575  MerR family transcriptional regulator, activator of bmr gene
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00765  Multidrug resistance, efflux pump Bmr
Brite
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   MerR family
    BSU24020 (bmrR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR GyrI-like Cass2 GAS DUF705
Motif
Other DBs
NCBI-GeneID: 938676
NCBI-ProteinID: NP_390282
Pasteur: BG10304
BSORF: BG10304
UniProt: P39075
Structure
PDB: 

Jmol
Position
2495898..2496734
Genome map
AA seq 278 aa AA seqDB search
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLK
YIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPA
LGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYT
SIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYI
ADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatcgtattactcaattggggaagtatcaaaactggcaaacgtgtcgataaaa
gcgctccgttattacgataaaattgatttatttaaaccagcctacgtcgacccggatacc
agctaccgctattatacagattctcagctcattcatctggatttgatcaaatcattgaaa
tatatcggcacacctttagaagagatgaaaaaagcacaggacttagagatggaagaactg
tttgctttttatacagagcaggagaggcaaatcagggagaaattagactttttatcagcc
ctggagcaaaccatttcattggtgaaaaagcggatgaaacggcagatggaatatcccgcg
ctcggtgaggtgtttgttttagatgaagaagaaatacggatcattcagacagaggcagaa
ggaatcgggcctgaaaacgtgctcaacgcctcctacagcaaattaaaaaaatttatcgag
tcagcagatggatttacgaacaatagctacggcgctactttctcttttcagccctacacc
agcattgatgaaatgacttaccgtcatattttcacacctgtattgacgaataaacagatt
tcatcaattacgccggatatggaaatcacaacgatccctaaagggaggtatgcgtgtatc
gcgtataatttttcgcctgaacattattttctcaacttacagaagcttatcaaatatatc
gcggaccgccaattaacagttgtcagtgatgtatacgagttaatcataccgattcattac
tccccgaaaaaacaagaagaatatcgagtcgaaatgaaaatacggatcgctgaataa

DBGET integrated database retrieval system