KEGG   Bacillus subtilis subsp. subtilis 168: BSU24020Help
Entry
BSU24020          CDS       T00010                                 

Gene name
bmrR
Definition
MerR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
2495898..2496734
Genome map
AA seq 278 aa AA seqDB search
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLK
YIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPA
LGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYT
SIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYI
ADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatcgtattactcaattggggaagtatcaaaactggcaaacgtgtcgataaaa
gcgctccgttattacgataaaattgatttatttaaaccagcctacgtcgacccggatacc
agctaccgctattatacagattctcagctcattcatctggatttgatcaaatcattgaaa
tatatcggcacacctttagaagagatgaaaaaagcacaggacttagagatggaagaactg
tttgctttttatacagagcaggagaggcaaatcagggagaaattagactttttatcagcc
ctggagcaaaccatttcattggtgaaaaagcggatgaaacggcagatggaatatcccgcg
ctcggtgaggtgtttgttttagatgaagaagaaatacggatcattcagacagaggcagaa
ggaatcgggcctgaaaacgtgctcaacgcctcctacagcaaattaaaaaaatttatcgag
tcagcagatggatttacgaacaatagctacggcgctactttctcttttcagccctacacc
agcattgatgaaatgacttaccgtcatattttcacacctgtattgacgaataaacagatt
tcatcaattacgccggatatggaaatcacaacgatccctaaagggaggtatgcgtgtatc
gcgtataatttttcgcctgaacattattttctcaacttacagaagcttatcaaatatatc
gcggaccgccaattaacagttgtcagtgatgtatacgagttaatcataccgattcattac
tccccgaaaaaacaagaagaatatcgagtcgaaatgaaaatacggatcgctgaataa

DBGET integrated database retrieval system