KEGG   Bacillus subtilis subsp. subtilis 168: BSU24680Help
Entry
BSU24680          CDS       T00010                                 

Gene name
comGF
Definition
(RefSeq) ComG operon protein 6
  KO
K02248  
competence protein ComGF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BSU24680 (comGF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2556512..2556895)
Genome map
AA seq 127 aa AA seqDB search
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNL
SGQDIRFDIYHSMIRKRVDGKGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPV
YSYLGGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttgctcatatcaggatcgttagctgcgattatccatctgtttttgtctcgacagcaggaa
catgacggtttcacacagcaggaatggatgatttcgatagaacagatgatgaatgaatgc
aaggaatcacaggcagttaagacagccgagcatgggagcgtgttaatctgcaccaatctt
tccggacaagacatccgttttgacatttatcattcaatgataagaaaaagagtggatggc
aaagggcatgttccgattttagatcatattactgccatgaaagctgatattgaaaatggt
gttgttttgctgaaaattgagagtgaagaccaaaaagtgtatcaaactgcttttccagtc
tattcgtatttaggaggggggtga

DBGET integrated database retrieval system