KEGG   Bacillus subtilis subsp. subtilis 168: BSU24730Help
Entry
BSU24730          CDS       T00010                                 

Gene name
comGA
Definition
(RefSeq) ComG operon protein 1
  KO
K02243  
competence protein ComGA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BSU24730 (comGA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2559007..2560077)
Genome map
AA seq 356 aa AA seqDB search
MDSIEKVSKNLIEEAYLTKASDIHIVPRERDAIIHFRVDHALLKKRDMKKEECVRLISHF
KFLSAMDIGERRKPQNGSLTLKLKEGNVHLRMSTLPTINEESLVIRVMPQYNIPSIDKLS
LFPKTGATLLSFLKHSHGMLIFTGPTGSGKTTTLYSLVQYAKKHFNRNIVTLEDPVETRD
EDVLQVQVNEKAGVTYSAGLKAILRHDPDMIILGEIRDAETAEIAVRAAMTGHLVLTSLH
TRDAKGAIYRLLEFGINMNEIEQTVIAIAAQRLVDLACPFCENGCSSVYCRQSRNTRRAS
VYELLYGKNLQQCIQEAKGNHANYQYQTLRQIIRKGIALGYLTTNNYDRWVYHEKD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttggattcaatagaaaaggtaagcaaaaacttgattgaagaggcatatctaacaaaggct
tctgatattcacattgtgccgagggagcgggacgctatcattcattttcgggtcgatcat
gccttgctgaaaaaaagggacatgaaaaaagaagagtgcgtaagactgatttcacatttt
aaatttctttcagcaatggatataggtgaaaggcgaaagccgcaaaacggttcgcttacg
ttaaagttgaaagagggaaatgttcatttaagaatgtcaacgctgcccacaattaatgaa
gaaagcctcgtgatcagagtgatgccccaatacaatatcccttcgattgataaattgtcg
ctatttccgaagacaggagccacattactctcgtttttaaaacattcccatggcatgctc
atttttaccgggccgactggttcagggaagactaccacattatactctctcgttcaatat
gcaaaaaaacactttaatcgaaatattgtcacattagaggaccctgttgaaacaagggac
gaagatgttcttcaggttcaggtgaatgaaaaagccggtgtaacttattccgcaggtctg
aaagcaattttgcgccatgaccccgatatgattattttaggtgagatcagagacgcggaa
acagctgaaattgcggtgcgggcagcgatgacgggacatctggtactaacgagccttcat
acgagagacgcaaagggcgcaatttacagactgcttgaattcggtatcaatatgaatgaa
atcgaacagactgtcattgcaatagcggctcagcgcttggttgatttggcttgcccgttt
tgtgaaaacggatgttcatcagtgtattgccgacagtcacgaaatactaggagagctagc
gtttatgagcttctatacgggaaaaatcttcagcaatgtatccaggaggcaaaaggaaat
catgcaaattaccaatatcaaacgcttcgtcaaattatcagaaaaggaattgcgctcggc
tatttaacgacaaacaactatgaccggtgggtttatcatgaaaaagattag

DBGET integrated database retrieval system