KEGG   Bacillus subtilis subsp. subtilis 168: BSU24960Help
Entry
BSU24960          CDS       T00010                                 

Gene name
pstBA
Definition
(RefSeq) phosphate import ATP-binding protein PstB 2
  KO
K02036  
phosphate transport system ATP-binding protein [EC:3.6.3.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
ABC transporters
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU24960 (pstBA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.27  phosphate-transporting ATPase
     BSU24960 (pstBA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    BSU24960 (pstBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2578003..2578812)
Genome map
AA seq 269 aa AA seqDB search
MSEQMVKEKPERAVIVPKQNHVLEVKDLSIYYGNKQAVHHVNMDIEKNAVTALIGPSGCG
KSTFLRNINRMNDLIPSARAEGEILYEGLNILGGNINVVSLRREIGMVFQKPNPFPKSIY
ANITHALKYAGERNKAVLDEIVEESLTKAALWDEVKDRLHSSALSLSGGQQQRLCIARTL
AMKPAVLLLDEPASALDPISNAKIEELITGLKREYSIIIVTHNMQQALRVSDRTAFFLNG
ELVEYGQTEQIFTSPKKQKTEDYINGKFG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacaaatggtaaaagaaaaacctgagcgagctgttattgttccgaagcagaac
cacgtgcttgaggtcaaagatctgtccatttattacggaaataaacaagccgttcatcat
gtaaacatggatattgaaaaaaatgcggtgactgctttaattgggccgtcgggatgcgga
aaatctacttttttgagaaatattaaccgaatgaacgatttaattccatctgcaagagcg
gaaggtgaaatcctttatgagggattaaatatattgggcggcaatattaacgttgtcagc
ttgagaagagaaatcggaatggttttccaaaaaccaaatccatttccgaaatcgatctat
gcgaatatcacacatgcattgaaatatgccggagagcggaataaagctgttttagatgaa
attgtggaagaaagtttaacaaaagcagcgctctgggatgaggtgaaggatcgtttacat
tcatccgcactctcgttatccggcggccagcagcagcgtttatgcatcgcgagaacgctt
gcgatgaagccggctgttcttctgcttgatgaaccagcttcagcgcttgatccgatttca
aatgcaaaaatagaggaattaattacaggattgaaaagagaatactcaattattattgtc
acgcacaatatgcagcaggctctgcgggtttctgaccggacggcattctttttaaacggc
gagcttgtagaatacggacagaccgaacagattttcacgagtccgaaaaagcaaaagaca
gaggattatattaacgggaaattcggatag

DBGET integrated database retrieval system