KEGG   Bacillus subtilis subsp. subtilis 168: BSU25020Help
Entry
BSU25020          CDS       T00010                                 

Gene name
sodA
Definition
superoxide dismutase (EC:1.15.1.1)
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSU25020 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2585434..2586042)
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD
LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFA
AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaacttccagaattaccttatgcgtacgatgctttagaaccgcatatcgac
aaggaaactatgactattcaccatacgaaacaccacaacacatacgtgacaaatttaaac
aaagcggttgaaggaaacactgctcttgccaacaaatcagttgaagagcttgttgcagat
cttgattctgttcctgaaaacatccgcactgcagtccgcaacaacggcggcggacacgcg
aaccacaaattattctggacacttttatctccaaacggcggaggcgaaccgactggcgcg
cttgctgaagagattaacagtgtatttggaagctttgacaaattcaaagagcaattcgca
gcagcagcagctggacgcttcggttctggctgggcatggcttgttgtgaacaacggtaaa
cttgaaatcacaagcacgccaaaccaagattctccgctttcagaaggcaaaacgcctatc
ttaggtcttgacgtttgggagcatgcttactaccttaactatcaaaaccgccgtcctgat
tacatttcagctttctggaatgttgtaaactgggacgaagtggctcgtctatacagcgaa
gcaaaataa

DBGET integrated database retrieval system