KEGG   Bacillus subtilis subsp. subtilis 168: BSU25140Help
Entry
BSU25140          CDS       T00010                                 

Gene name
cshB
Definition
(RefSeq) DEAD/DEAH box helicase
  KO
K18692  
ATP-dependent RNA helicase CshB [EC:3.6.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BSU25140 (cshB)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU25140 (cshB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA helicases
   BSU25140 (cshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2594184..2595500)
Genome map
AA seq 438 aa AA seqDB search
MKETKFELYELKPFIIDAVHRLGFYEPTDIQKRLIPAVLKKESVIGQSQTGTGKTHAYLL
PLLNKIDPAKDVVQVVITAPTRELANQIYQEALKITQGEEGSQIRSKCFIGGTDKQKSID
KLKIQPHLVVGTPGRIADLIKEQALSVHKAESLVIDEADLMLDMGFLADVDYIGSRMPED
LQMLVFSATIPEKLKPFLKKYMENPKYAHVEPKQVTAAKIEHILIPSKHRDKDKLLFDIM
SHLNPYLGIVFANTKNTADHIAQYLTGKGMKIGLLHGGLTPRERKKVMKQINDLEFTYII
ATDLAARGIDIKGVSHVINYELPDDLDFYVHRVGRTARAGSSGQAMTIYELTDEDALVRL
EKMGIEFEYLELEKGEWKKGDDRQRRKKRKKTPNEADEIAHRLVKKPKKVKPGYKKKMSY
EMEKIKKKQRRNQSKKRK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacgaaatttgaactttatgaattgaaaccatttattatagatgcagtacat
cgccttggtttttacgaaccgactgatatccagaaaaggctgattcctgcagtgttaaaa
aaagaaagcgtcatcggccagtctcagacgggtactggaaagactcacgcttatttactg
cctttattaaacaaaatcgatcctgctaaggatgtcgttcaggtagtcattacggctccg
acaagagagcttgccaaccagatttatcaggaagcgcttaaaatcacgcagggtgaagaa
ggaagtcagattcgctcgaaatgttttatcggaggcactgataaacaaaaatcaattgat
aaattgaaaatacagccgcatcttgttgtcggtacacctggacggattgctgacttaatc
aaagaacaggcgttaagtgttcataaagcggaatctcttgttattgatgaagcggattta
atgctggacatgggattccttgcagatgtagattacatcggttcccgcatgcctgaggat
ctgcaaatgcttgtgttctcagcgaccataccggaaaagctgaaaccattcttgaagaaa
tacatggaaaatccgaaatacgcccatgtggagccaaaacaggtgactgctgcgaaaatc
gagcatatcctcattccttcgaaacatcgtgacaaggacaagctcctttttgacatcatg
tcgcatctgaatccatacctggggattgtgtttgccaacacgaaaaatacggctgaccat
attgcccagtatctgactggcaaaggcatgaaaatcggcttgctgcacggcggattaaca
ccacgtgagcggaaaaaagtcatgaagcagatcaatgatttggaattcacatatatcatt
gcaactgaccttgccgcaagaggtattgatattaaaggtgtcagccatgttatcaactat
gagctgccggatgatctcgatttctatgttcaccgtgtgggcagaacggctcgtgccggc
tcatcaggacaagcgatgaccatttatgagcttactgatgaggatgcattagtaagactt
gaaaaaatgggcatcgaatttgagtacttagagcttgaaaagggcgaatggaaaaaaggc
gatgaccgtcagcgccgcaaaaaacgtaaaaaaacgccgaatgaagcggatgaaattgct
catcgtctcgtgaaaaagccgaagaaggttaagcctgggtataaaaagaaaatgagctat
gagatggagaaaatcaagaaaaaacagagaagaaaccaatctaagaaaagaaagtag

DBGET integrated database retrieval system