KEGG   Bacillus subtilis subsp. subtilis 168: BSU25450Help
Entry
BSU25450          CDS       T00010                                 

Gene name
prmA
Definition
(RefSeq) ribosomal protein L11 methyltransferase
  KO
K02687  
ribosomal protein L11 methyltransferase [EC:2.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSU25450 (prmA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  ribosomal protein modification factors
   BSU25450 (prmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2623825..2624760)
Genome map
AA seq 311 aa AA seqDB search
MKWSELSIHTTHEAVEPISNILHEAGASGVVIEDPLDLIKERENVYGEIYQLDPNDYPDE
GVIVKAYLPVNSFLGETVDGIKETINNLLLYNIDLGRNHITISEVNEEEWATAWKKYYHP
VKISEKFTIVPTWEEYTPVHTDELIIEMDPGMAFGTGTHPTTVLCIQALERFVQKGDKVI
DVGTGSGILSIAAAMLEAESVHAYDLDPVAVESARLNLKLNKVSDIAQVKQNNLLDGIEG
EHDVIVANILAEVILRFTSQAYSLLKEGGHFITSGIIGHKKQEVKEALEQAGFTIVEILS
MEDWVSIIAKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatggtccgaattaagcattcacacaacacatgaagcggtcgaacctatctcaaat
atattgcatgaagctggtgcaagtggggttgtgatagaggacccgcttgatttaattaaa
gaacgtgagaatgtgtacggggaaatctaccagctcgaccccaatgattacccagatgag
ggtgtcattgtcaaagcatatctgccggttaacagttttctgggcgaaactgtagacggc
atcaaagaaacgattaataatctccttctttacaatattgatttgggcagaaaccacatc
actatttctgaagtaaatgaagaagagtgggcgactgcctggaaaaagtattatcatcct
gtgaaaatttctgaaaagtttacaattgtgccgacgtgggaggaatatacgccggtccat
actgatgaactgattattgaaatggacccgggaatggctttcggcacagggacacatccg
acaaccgtactctgcattcaggcgcttgaacgctttgtgcaaaagggtgataaggtgatt
gatgtcggcactggttcgggaattttaagtattgcggctgcaatgcttgaggctgaatcg
gttcatgcctacgatcttgatcccgtggctgtagaaagtgcacgcctcaatctcaagctg
aacaaagtcagcgatattgctcaagtgaagcaaaacaatttgttagacgggattgaaggg
gaacatgatgtgattgtggccaacattttggctgaagtcattcttcgctttacttcacaa
gcgtacagcctgttaaaagaaggcggtcactttattacgtcaggaatcatcggtcataaa
aaacaagaagtaaaagaagcactggaacaagctggctttaccattgtagaaatcctttca
atggaagattgggtcagcattattgcgaaaaaataa

DBGET integrated database retrieval system