KEGG   Bacillus subtilis subsp. subtilis 168: BSU26430Help
Entry
BSU26430          CDS       T00010                                 

Gene name
yrkP
Definition
(RefSeq) transcriptional regulator
  KO
K02483  
two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU26430 (yrkP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2704435..2705130)
Genome map
AA seq 231 aa AA seqDB search
MAYRILVVEDDEDIGDLLEESLTRAGYEVLRAKDGKRALQLVNDSLDLVILDIMMPGISG
IETCQHIRKSSNVPILFLTARSSTLDKTEGLLAGGDDYMTKPFSEEELHARVIAQLRRYT
IYQEKKEQEETFLIGGKLRVSEEFNEVWKEEKQIKLSDLEYRILKLLMNKRNKIFSAQNI
YESVWGQPYFYCSNNTVMVHIRKLRSKIEDDPARPVYIKTEWGRGYRFGAS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcgaatattagtcgtagaggatgatgaggatattggtgatcttttggaggaa
tcccttacacgtgcaggttacgaggtgctaagagccaaggatggaaagcgagcattgcaa
cttgtgaatgactcgcttgatttggttattttggatattatgatgccaggcatttcggga
attgaaacatgtcagcacatcaggaaatcctctaacgtcccgattctgtttctgacggcc
agatcgagtacactcgataaaactgagggattactcgccggcggcgatgattatatgact
aaaccattctcggaagaggaacttcacgctagagtgattgctcaattacgcagatatact
atctatcaggaaaagaaggaacaggaagaaacatttcttatcgggggcaaactaagagtg
agcgaagaatttaatgaggtgtggaaagaggagaagcaaatcaagttgtcagatctggag
tatcgtatcctgaaacttctgatgaacaaacgcaacaaaatattttctgcccaaaatata
tatgagagtgtgtggggacagccttacttttactgttccaacaatacggtgatggtgcat
atacggaagctgcgctccaaaattgaggatgatccggcacgtccggtttatataaaaact
gaatggggaagaggatatcgatttggcgcatcttaa

DBGET integrated database retrieval system